DECR1 Antibody (3D4)

Images

 
Western Blot: DECR1 Antibody (3D4) [H00001666-M01] - DECR1 monoclonal antibody (M01), clone 3D4. Analysis of DECR1 expression in HepG2.
Immunohistochemistry-Paraffin: DECR1 Antibody (3D4) [H00001666-M01] - Analysis of monoclonal antibody to DECR1 on formalin-fixed paraffin-embedded human heart. Antibody concentration 3 ug/ml.
Sandwich ELISA: DECR1 Antibody (3D4) [H00001666-M01] - Detection limit for recombinant GST tagged DECR1 is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC-P
Clone
3D4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

DECR1 Antibody (3D4) Summary

Immunogen
DECR1 (NP_001350 236 a.a. - 335 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NVIQPGPIKTKGAFSRLDPTGTFEKEMIGRIPCGRLGTVEELANLAAFLCSDYASWINGAVIKFDGGEEVLISGEFNDLRKVTKEQWDTIEELIRKTKGS
Specificity
DECR1 - 2,4-dienoyl CoA reductase 1, mitochondrial (3D4)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
DECR1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for DECR1 Antibody (3D4)

  • 2,4-dienoyl CoA reductase 1, mitochondrial
  • 4-enoyl-CoA reductase [NADPH]
  • 4-enoyl-CoA reductase
  • DECR
  • DECR1
  • DECR2,4-dienoyl-CoA reductase [NADPH]2,4-dienoyl-CoA reductase, mitochondrial
  • EC 1.3.1.34
  • NADPH
  • SDR18C1
  • short chain dehydrogenase/reductase family 18C, member 1

Background

This gene encodes an accessory enzyme which participates in the beta-oxidation and metabolism of unsaturated fatty enoyl-CoA esters. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1067
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, Neut
AF1067
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, Neut
NBP2-41103
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF8537
Species: Mu, Rt
Applications: WB, Simple Western, ICC
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
NBP2-24530
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P, Flow-IC
NB400-114
Species: Hu, Mu, Rt, Po, Ch, Fe, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00152503-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-84974
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00007071-M15
Species: Hu, Mu, Rt
Applications: WB, ELISA
NB500-317
Species: Hu, Bv(-), Ca(-), Ch(-), Mu(-), Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, RIA
AF6574
Species: Mu
Applications: WB
NBP1-81858
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89512
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB110-60930
Species: Hu, Mu
Applications: WB

Publications for DECR1 Antibody (H00001666-M01) (0)

There are no publications for DECR1 Antibody (H00001666-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DECR1 Antibody (H00001666-M01) (0)

There are no reviews for DECR1 Antibody (H00001666-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DECR1 Antibody (H00001666-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for DECR1 Antibody (H00001666-M01)

Discover related pathways, diseases and genes to DECR1 Antibody (H00001666-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DECR1 Antibody (H00001666-M01)

Discover more about diseases related to DECR1 Antibody (H00001666-M01).
 

Pathways for DECR1 Antibody (H00001666-M01)

View related products by pathway.

PTMs for DECR1 Antibody (H00001666-M01)

Learn more about PTMs related to DECR1 Antibody (H00001666-M01).

Blogs on DECR1

There are no specific blogs for DECR1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DECR1 Antibody (3D4) and receive a gift card or discount.

Bioinformatics

Gene Symbol DECR1
Entrez
Uniprot