Home » DECR1 » DECR1 Antibodies » DECR1 Antibody (3D4)

DECR1 Antibody (3D4)

 Submit a Review

Images

 
(
Enlarge)
Western Blot: DECR1 Antibody (3D4) [H00001666-M01] - DECR1 monoclonal antibody (M01), clone 3D4. Analysis of DECR1 expression in HepG2.
Western Blot: DECR1 Antibody (3D4) [H00001666-M01] - DECR1 monoclonal antibody (M01), clone 3D4. Analysis of DECR1 expression in HepG2.
Immunohistochemistry-Paraffin: DECR1 Antibody (3D4) [H00001666-M01] - Analysis of monoclonal antibody to DECR1 on formalin-fixed paraffin-embedded human heart. Antibody concentration 3 ug/ml.
Sandwich ELISA: DECR1 Antibody (3D4) [H00001666-M01] - Detection limit for recombinant GST tagged DECR1 is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC-P
Clone
3D4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

DECR1 Antibody (3D4) Summary

Immunogen
DECR1 (NP_001350 236 a.a. - 335 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NVIQPGPIKTKGAFSRLDPTGTFEKEMIGRIPCGRLGTVEELANLAAFLCSDYASWINGAVIKFDGGEEVLISGEFNDLRKVTKEQWDTIEELIRKTKGS
Specificity
DECR1 - 2,4-dienoyl CoA reductase 1, mitochondrial (3D4)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
DECR1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for DECR1 Antibody (3D4)

  • 2,4-dienoyl CoA reductase 1, mitochondrial
  • 4-enoyl-CoA reductase [NADPH]
  • 4-enoyl-CoA reductase
  • DECR
  • DECR1
  • DECR2,4-dienoyl-CoA reductase [NADPH]2,4-dienoyl-CoA reductase, mitochondrial
  • EC 1.3.1.34
  • NADPH
  • SDR18C1
  • short chain dehydrogenase/reductase family 18C, member 1

Background

This gene encodes an accessory enzyme which participates in the beta-oxidation and metabolism of unsaturated fatty enoyl-CoA esters. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Growth Hormone
Antibody [Unconjugate
AF1067
Growth Hormone was detected in immersion fixed paraffin-embedded sections of human pituitary using Goat Anti-Human/Mouse/Rat Growth Hormone Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1067) at 10 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Lower panel shows a lack of labeling if primary antibodies are omitted and tissue is stained only with secondary antibody followed by incubation with detection reagents. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Western blot shows lysates of human, mouse, and rat pituitary gland tissue. PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human Growth Hormone Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1067) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for Growth Hormone at approximately 22 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Recombinant Human Growth Hormone protein was serially diluted 2-fold and captured by Mouse Anti-Human Growth Hormone Monoclonal Antibody (Catalog # MAB10671) coated on a Clear Polystyrene Microplate (Catalog # DY990). Goat Anti-Human/Mouse/Rat Growth Hormone Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1067) was biotinylated and incubated with the protein captured on the plate. Detection of the standard curve was achieved by incubating Streptavidin-HRP (Catalog # DY998) followed by Substrate Solution (Catalog # DY999) and stopping the enzymatic reaction with Stop Solution (Catalog # DY994).
(3 Reviews)
(6 Publications)
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, Neut
Growth Hormone
Antibody [Unconjugate
AF1067
Growth Hormone was detected in immersion fixed paraffin-embedded sections of human pituitary using Goat Anti-Human/Mouse/Rat Growth Hormone Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1067) at 10 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Lower panel shows a lack of labeling if primary antibodies are omitted and tissue is stained only with secondary antibody followed by incubation with detection reagents. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Western blot shows lysates of human, mouse, and rat pituitary gland tissue. PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human Growth Hormone Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1067) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for Growth Hormone at approximately 22 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Recombinant Human Growth Hormone protein was serially diluted 2-fold and captured by Mouse Anti-Human Growth Hormone Monoclonal Antibody (Catalog # MAB10671) coated on a Clear Polystyrene Microplate (Catalog # DY990). Goat Anti-Human/Mouse/Rat Growth Hormone Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1067) was biotinylated and incubated with the protein captured on the plate. Detection of the standard curve was achieved by incubating Streptavidin-HRP (Catalog # DY998) followed by Substrate Solution (Catalog # DY999) and stopping the enzymatic reaction with Stop Solution (Catalog # DY994).
(3 Reviews)
(6 Publications)
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, Neut
Melanocortin-4 R
Antibody
NBP2-41103
Western Blot: Melanocortin-4 R Antibody [NBP2-41103] - Western blot analysis of MC4R in rat brain tissue lysate with MC4R antibody at 1 ug/mL in (A) the absence and (B) the presence of blocking peptide.
Immunocytochemistry/Immunofluorescence: Melanocortin-4 R Antibody [NBP2-41103] - Immunofluorescence of MC4R in Human Brain cells with MC4R antibody at 20 ug/mL.
Immunohistochemistry: Melanocortin-4 R Antibody [NBP2-41103] - Immunohistochemistry of MC4R in human brain tissue with MC4R antibody at 2.5 ug/mL.
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
ErbB2/Her2
[Unconjugated]
1129-ER
1 μg/lane of Recombinant Human ErbB2 Fc Chimera was resolved with SDS-PAGE under reducing (R) and non-reducing (NR) conditions and visualized by silver staining, showing major bands at 125-130 kDa and  220-250 kDa, respectively.
Recombinant Human ErbB2/Her2 Fc Chimera (Catalog # 1129-ER) blocks anti-ErbB2 mediated inhibition of the SK‑BR‑3 human breast cancer cell line. The ED50 is 20-80 ng/mL in the presence of 0.6 μg/mL Goat Anti-Human ErbB2/Her2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1129)
(5 Reviews)
(27 Publications)
Species: Hu
alpha
1B-Glycoprotein Antib ...
AF8537
Western blot shows mouse plasma and rat plasma. PVDF membrane was probed with 1:1000 dilution of Rabbit Anti-Mouse/Rat alpha 1B-Glycoprotein Antigen Affinity-purified Polyclonal Antibody (Catalog # AF8537) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for alpha 1B-Glycoprotein at approximately 75 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
alpha 1B-Glycoprotein was detected in immersion fixed Hepa 1‑6 mouse hepatoma cell line using Rabbit Anti-Mouse/Rat alpha 1B-Glycoprotein Antigen Affinity-purified Polyclonal Antibody (Catalog # AF8537) at 1:20 dilution for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Rabbit IgG Secondary Antibody (red; Catalog # NL004) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Simple Western lane view shows lysates mouse plasma and rat plasma, loaded at 0.2 mg/mL. A specific band was detected for alpha 1B-Glycoprotein at approximately 113 kDa (as indicated) using 1:100 dilution of Rabbit Anti-Mouse/Rat alpha 1B-Glycoprotein Antigen Affinity-purified Polyclonal Antibody (Catalog # AF8537). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
Species: Mu, Rt
Applications: WB, Simple Western, ICC
RFC2 Antibody
(OTI2B2)
NBP2-45570
Western Blot: RFC2 Antibody (2B2) [NBP2-45570] - Analysis of HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY RFC2.
Immunohistochemistry: RFC2 Antibody (2B2) [NBP2-45570] - Analysis of Adenocarcinoma of Human endometrium tissue.
Flow Cytometry: RFC2 Antibody (2B2) [NBP2-45570] - Analysis of HEK293T cells transfected with either overexpress plasmid(Red) or empty vector control plasmid(Blue) were immunostained by RFC2 antibody.
Species: Hu
Applications: WB, Flow, IHC
Latexin Antibody
NBP2-24530
Western Blot: Latexin Antibody [NBP2-24530] - Analysis of Latexin in human pancreas lysate in the 1) absence and 2) presence of immunizing peptide using Latexin antibody at 0.01 ug/ml.
Immunohistochemistry-Paraffin: Latexin Antibody [NBP2-24530] - Formalin-fixed paraffin-embedded human small intestine stained with Latexin antibody at 5 ug/ml. Staining of formalin-fixed tissues is enhanced by boiling tissue sections in 10 mM sodium citrate buffer, pH 6.0 for 10-20 min followed by cooling at RT for 20 min.
Flow (Intracellular): Latexin Antibody [NBP2-24530] - Cytoclasmic staining of PBMC's(lymphocyte gate at 1 x 10^6 cells/ml) with Latexin antibody (orange) stained at a dilution of 1:1000. Detected with a GtxRb Dylight 488 secondary. Shown with the secondary control (blue).
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P, Flow-IC
Fatty Acid
Synthase/FASN Antibod
NB400-114
Western Blot: Fatty Acid Synthase Antibody [NB400-114] - Expression of Fatty Acid Synthase in chicken hypothalamus. A: total RNA (1 ug) isolated from different tissues (brain, hypothalamus, liver and muscle) was subjected to RT-PCR using specific primers for chicken Fatty Acid Synthase (GenBank accession JO4485) or ribosomal 18S as a control (GenBank accession AF173612) B: tissue lysates (brain, hypothalmus, liver and muscle) were subjected to Western blot as described in MATERIALS AND METHODS. Blots were incubated with anti-Fatty Acid Synthase antibody and revealed by enhanced chemiluminescence. Picture compliments of Dridi S. et al, Am J Physiol Regul Integr Comp Physiol. 2006 Jul;291(1):R138-47. Epub 2006 Feb 2.
Immunocytochemistry/Immunofluorescence: Fatty Acid Synthase Antibody [NB400-114] - The Fas antibody was tested in MCF-7 cells at a 1:2000 dilution against Dylight 488 (Green). Alpha tubulin and nuclei were counterstained against Dylight 550 (Red) and DAPI (Blue), respectively.
Immunohistochemistry-Paraffin: Fatty Acid Synthase Antibody [NB400-114] - Immunohistochemical localization of FAS in chicken hypothalmus. Paraffin sections were obtained from 3-wk-old broiler chickens.
(2 Reviews)
(18 Publications)
Species: Hu, Mu, Rt, Po, Ch, Fe, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
SH3D19 Antibody
(5C7)
H00152503-M01
Western Blot: SH3D19 Antibody (5C7) [H00152503-M01] - SH3D19 monoclonal antibody (M01), clone 5C7 Analysis of SH3D19 expression in HeLa.
Immunocytochemistry/Immunofluorescence: SH3D19 Antibody (5C7) [H00152503-M01] - Analysis of monoclonal antibody to SH3D19 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: SH3D19 Antibody (5C7) [H00152503-M01] - Analysis of monoclonal antibody to SH3D19 on formalin-fixed paraffin-embedded human esophagus. Antibody concentration 3 ug/ml.
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
ACAA2 Antibody
NBP1-84974
Western Blot: ACAA2 Antibody [NBP1-84974] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/Immunofluorescence: ACAA2 Antibody [NBP1-84974] - Immunofluorescent staining of human cell line CACO-2 shows localization to mitochondria.
Immunohistochemistry-Paraffin: ACAA2 Antibody [NBP1-84974] - Staining in human kidney and pancreas tissues using anti-ACAA2 antibody. Corresponding ACAA2 RNA-seq data are presented for the same tissues.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
KLF10 Antibody
(1H3)
H00007071-M15
Western Blot: KLF10 Antibody (1H3) [H00007071-M15] - Analysis of KLF10 expression in NIH/3T3 (Cat # L018V1).
Western Blot: KLF10 Antibody (1H3) [H00007071-M15] - Analysis of KLF10 expression in PC-12 (Cat # L012V1).
Western Blot: KLF10 Antibody (1H3) [H00007071-M15] - Analysis of KLF10 expression in A-549 (Cat # L025V1).
Species: Hu, Mu, Rt
Applications: WB, ELISA
beta
2-Microglobulin Antib
NB500-317
Western Blot: beta 2-Microglobulin Antibody (B2M-01) [NB500-317] - Analysis using the FITC conjugate of NB500-317. Detection (non-reducing conditions) of whole cell lysate of various cell lines Lane 1: RAJI human Burkitt lymphoma cell line Lane 2: EL4 mouse lymphoblastic lymphoma cell line Lane 3: U937 human histiocytic lymphoma cell line.
Immunocytochemistry/Immunofluorescence: beta 2-Microglobulin Antibody (B2M-01) [NB500-317] - Confocal microscopy of human beta2-microglobulin-transfected canine cells labeled A) with B2M-01 antibody Alexa Fluor (R) 647 conjugate and B) with Alexa Fluor (R) 647 conjugated Mouse IgG2a Isotype Control. Cells were fixed with 4% PFA and permeabilized with 0.1% PBS-Tween20 containing 2% BSA. Antibody concentration 2ug/ml.
Flow Cytometry: beta 2-Microglobulin Antibody (B2M-01) [NB500-317] - Surface staining of beta2-microglobulin in human peripheral blood with anti-beta2-microglobulin (B2M-01) PE.
(2 Publications)
Species: Hu, Bv(-), Ca(-), Ch(-), Mu(-), Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, RIA
THRSP Antibody
AF6574
Western blot shows lysates of mouse liver tissue. PVDF Membrane was probed with 0.5 µg/mL of Mouse THRSP Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6574) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for THRSP at approximately 20 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Species: Mu
Applications: WB
RNF130 Antibody
NBP1-81858
Western Blot: RNF130 Antibody [NBP1-81858] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-478
Immunohistochemistry-Paraffin: RNF130 Antibody [NBP1-81858] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
Species: Hu
Applications: WB, IHC, IHC-P
Glycine
N-Methyltransferase/G ...
NBP1-89512
Immunocytochemistry/Immunofluorescence: Glycine N-Methyltransferase/GNMT Antibody [NBP1-89512] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
Immunohistochemistry-Paraffin: Glycine N-Methyltransferase/GNMT Antibody [NBP1-89512] - Staining in human pancreas and colon tissues using anti-GNMT antibody. Corresponding GNMT RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Glycine N-Methyltransferase/GNMT Antibody [NBP1-89512] - Staining of human colon shows low expression as expected.
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Gastric Lipase
Antibody
NB110-60930
Western Blot: Gastric Lipase Antibody [NB110-60930] - Detection of LIPF in liver lysate using NB110-60930. Lane 1: human Lane 2: mouse
Species: Hu, Mu
Applications: WB

Publications for DECR1 Antibody (H00001666-M01) (0)

There are no publications for DECR1 Antibody (H00001666-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DECR1 Antibody (H00001666-M01) (0)

There are no reviews for DECR1 Antibody (H00001666-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DECR1 Antibody (H00001666-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for DECR1 Antibody (H00001666-M01)

Discover related pathways, diseases and genes to DECR1 Antibody (H00001666-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DECR1 Antibody (H00001666-M01)

Discover more about diseases related to DECR1 Antibody (H00001666-M01).
 

Pathways for DECR1 Antibody (H00001666-M01)

View related products by pathway.

PTMs for DECR1 Antibody (H00001666-M01)

Learn more about PTMs related to DECR1 Antibody (H00001666-M01).

Blogs on DECR1

There are no specific blogs for DECR1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DECR1 Antibody (3D4) and receive a gift card or discount.


Bioinformatics

Gene Symbol DECR1
Entrez
Uniprot