DDX6 Recombinant Protein Antigen

Images

 
There are currently no images for DDX6 Recombinant Protein Antigen (NBP1-83249PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

DDX6 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DDX6.

Source: E.coli

Amino Acid Sequence: ENPVIMGLSSQNGQLRGPVKPTGGPGGGGTQTQQQMNQLKNTNTINNGTQQQAQSMTTTIKPGDDWKKTLKLPPKDLRIKTSDVTSTKGNEFEDYCLKRELLMGIFEMGWEKPSPIQ

Protein/Peptide Type
Recombinant Protein Antigen
Gene
DDX6
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-83249.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related protocol, click here.
Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for DDX6 Recombinant Protein Antigen

  • ATP-dependent RNA helicase p54
  • DEAD (Asp-Glu-Ala-Asp) box polypeptide 6
  • DEAD box protein 6
  • DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 6 (RNA helicase, 54kD)
  • EC 3.6.1
  • EC 3.6.4.13
  • FLJ36338
  • HLR2DEAD box-6
  • Oncogene RCK
  • probable ATP-dependent RNA helicase DDX6
  • RCKP54

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-02060
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-92392
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00027161-M01
Species: Hu, Mu, Rt
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, RNAi
MAB1846
Species: Hu, Mu, Rt
Applications: WB, ICC
H00005706-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, RNAi
NB100-61045
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB500-138
Species: Hu
Applications: WB, IHC, IHC-P
NB100-74360
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-00918
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF1334
Species: Hu
Applications: WB, IHC
NBP1-68874
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-00764
Species: Hu
Applications: WB, Flow, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-88419
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83249PEP
Species: Hu
Applications: AC

Publications for DDX6 Recombinant Protein Antigen (NBP1-83249PEP) (0)

There are no publications for DDX6 Recombinant Protein Antigen (NBP1-83249PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DDX6 Recombinant Protein Antigen (NBP1-83249PEP) (0)

There are no reviews for DDX6 Recombinant Protein Antigen (NBP1-83249PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for DDX6 Recombinant Protein Antigen (NBP1-83249PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DDX6 Products

Bioinformatics Tool for DDX6 Recombinant Protein Antigen (NBP1-83249PEP)

Discover related pathways, diseases and genes to DDX6 Recombinant Protein Antigen (NBP1-83249PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DDX6 Recombinant Protein Antigen (NBP1-83249PEP)

Discover more about diseases related to DDX6 Recombinant Protein Antigen (NBP1-83249PEP).
 

Pathways for DDX6 Recombinant Protein Antigen (NBP1-83249PEP)

View related products by pathway.

PTMs for DDX6 Recombinant Protein Antigen (NBP1-83249PEP)

Learn more about PTMs related to DDX6 Recombinant Protein Antigen (NBP1-83249PEP).
 

Research Areas for DDX6 Recombinant Protein Antigen (NBP1-83249PEP)

Find related products by research area.

Blogs on DDX6

There are no specific blogs for DDX6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

DDX6 Antibody
NB200-191
DDX6 Antibody
NB200-191

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our DDX6 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol DDX6