DDX21 Antibody - BSA Free

Immunohistochemistry-Paraffin: DDX21 Antibody [NBP1-83310] - Analysis in human appendix and skeletal muscle tissues using NBP1-83310 antibody. Corresponding DDX21 RNA-seq data are presented for the same tissues.

Immunocytochemistry/Immunofluorescence: DDX21 Antibody [NBP1-83310] - Staining of human cell line U-251 MG shows localization to nucleus & nucleoli. Antibody staining shown in green.

Immunohistochemistry-Paraffin: DDX21 Antibody [NBP1-83310] - Staining of human appendix shows strong positivity in nucleoli in lymphoid tissue.

Immunohistochemistry-Paraffin: DDX21 Antibody [NBP1-83310] - Staining of human skeletal muscle shows no positivity in nucleoli in myocytes as expected.

Analysis in human cell lines Caco-2 and HeLa using Anti-DDX21 antibody. Corresponding DDX21 RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.

• Reactivity: Hu, Mu, Ze
• Applications: WB, Func, ICC/IF, IHC, ChIP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

DDX21 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KPKSDKTEEIAEEEETVFPKAKQVKKKAEPSEVDMNSPKSKKAKKKEEPSQNDISPKTKSLRKKKEPIEKKVV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DDX21
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Chromatin Immunoprecipitation (ChIP) Reported in scientific literature (PMID 25470060)
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • In vitro assay Reported in scientific literature (PMID:19729515)
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  DDX21 Protein (NBP1-83310PEP)

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 31128943). Use in Zebrafish reported in scientific literature (PMID:32231306).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for DDX21 Antibody - BSA Free

• DEAD (Asp-Glu-Ala-Asp) box polypeptide 21
• DEAD box protein 21
• DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 21
• DKFZp686F21172
• EC 3.6.1
• EC 3.6.4.13
• Gu protein
• GUA
• gu-alpha
• GURDB
• nucleolar RNA helicase 2
• Nucleolar RNA helicase Gu
• Nucleolar RNA helicase II
• RH II/Gu
• RH-II/GU
• RH-II/GuA
• RNA helicase II/Gu alpha

Background

DDX21 is a member of the DEAD box family of proteins that possesses several conserved motifs which include the highly conserved DEAD (Asp-Glu-Ala-Asp) amino acid sequence motif. The major activity of DEAD box proteins is to function as ATP-dependent RNA helicases. As helicases, DEAD proteins play an important role in all aspects of RNA metabolism and function which include pre-mRNA splicing, RNA synthesis, RNA degradation, RNA export, RNA translation, RNA secondary structure formation, ribosome biogenesis, and the assembly of RNP complexes. Some members of the DEAD box proteins also exhibit functions involved in transcriptional regulation. DDX21 has been shown to be required for the processing of 20S rRNA to 18S and has also been shown to be important for c-Jun transcriptional activation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for DDX21 Antibody (NBP1-83310)(13)

Publications using NBP1-83310

• Sun YM, Zhu SX, Chen XT, Pan Q et Al. lncRNAs maintain the functional phase state of nucleolar prion-like protein to facilitate rRNA processing Mol Cell 2024-11-23 [PMID: 39579766]
• Hao JD, Liu QL, Liu MX, Yang X et Al. DDX21 mediates co-transcriptional RNA m(6)A modification to promote transcription termination and genome stability Mol Cell 2024-04-03 [PMID: 38569554]
• Miao W, Porter DF, Lopez-Pajares V et al. Glucose dissociates DDX21 dimers to regulate mRNA splicing and tissue differentiation Cell 2023-01-05 [PMID: 36608661] (Human)
  
  Details:
  1:50 dilution used
• Shao W, Bi X, Pan Y et al. Phase separation of RNA-binding protein promotes polymerase binding and transcription Nature chemical biology 2022-01-01 [PMID: 34916619] (WB)
• Koltowska K, Okuda KS, Gloger M Et al. The RNA helicase Ddx21 controls Vegfc-driven developmental lymphangiogenesis by balancing endothelial cell ribosome biogenesis and p53 function Nature cell biology 2021-11-01 [PMID: 34750583] (ICC/IF, KD, WB, Human)
• McMahon KA, Stroud DA, Gambin Y et al. Cavin3 released from caveolae interacts with BRCA1 to regulate the cellular stress response eLife 2021-06-18 [PMID: 34142659]
• Putra V, Hulme AJ, Tee AE et al. The RNA-helicase DDX21 upregulates CEP55 expression and promotes neuroblastoma Molecular Oncology 2021-04-01 [PMID: 33497018] (In vitro assay, Human)
• Santoriello C, Sporrij A, Yang S et al. RNA helicase DDX21 mediates nucleotide stress responses in neural crest and melanoma cells Nat. Cell Biol. 2020-04-01 [PMID: 32231306] (ICC/IF, Zebrafish)
• Argaud D, Boulanger MC, Chignon A et al. Enhancer-mediated enrichment of interacting JMJD3-DDX21 to ENPP2 locus prevents R-loop formation and promotes transcription Nucleic Acids Res. 2019-06-28 [PMID: 31251802] (Chemotaxis, WB, Human)
• Krishnan P, Moreno PR, Turnbull IC et al. RNA Targets Ribogenesis Factor WDR43 to Chromatin for Transcription and Pluripotency Control Mol. Cell 2019-05-17 [PMID: 31128943] (ICC/IF, WB, Mouse)
• Calo E, Gu B, et al. Tissue-selective effects of nucleolar stress and rDNA damage in developmental disorders. Nature 2018-02-01 [PMID: 29364875]
• Calo E, Flynn RA, Martin L et al. RNA helicase DDX21 coordinates transcription and ribosomal RNA processing. Nature 2015-02-12 [PMID: 25470060] (Chemotaxis)
• Obrdlik A, Louvet E, Kukalev A et al. Nuclear myosin 1 is in complex with mature rRNA transcripts and associates with the nuclear pore basket. FASEB J 2010-01-01 [PMID: 19729515] (In vitro, Human)

Review for DDX21 Antibody (NBP1-83310) (1)

Average Rating: 3

(Based on 1 review)

We have 1 review tested in 1 species: Human.

reviewed by: Nadine Bakkar WB Human 09/26/2014

Summary

• Application: Western Blot
• Sample Tested: human brain lysate
• Species: Human

Bioinformatics

• Gene Symbol: DDX21