DCTN3 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: DCTN3 Antibody [NBP1-91823] - Staining of human cell line A-431 shows localization to nucleoli & cytosol.
Immunohistochemistry-Paraffin: DCTN3 Antibody [NBP1-91823] - Staining of human pancreas shows distinct cytoplasmic positivity in exocrine glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DCTN3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: FILSQVALLEQVNALVPMLDSAHIKAVPEHAARLQRLAQIHIQQQDQCVEITEESKALLEEYNKTTMLLSKQFVQWDELLCQLEAATQVKPA
Specificity
Specificity of human DCTN3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DCTN3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
DCTN3 Protein (NBP1-91823PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DCTN3 Antibody

  • DCTN22DCTN-22
  • dynactin 3 (p22)
  • dynactin 3
  • Dynactin complex subunit 22 kDa subunit
  • dynactin light chain
  • dynactin subunit 3
  • MGC111190
  • p22

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5758
Species: Hu
Applications: WB, IHC, ICC
NBP1-40974
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-Fr, IP
H00011214-M10
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP2-02300
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-13677
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB1904
Species: Hu
Applications: WB, IHC, ICC
NBP2-41291
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-22377
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-82454
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF3795
Species: Hu
Applications: WB, IP
NBP1-83139
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF2377
Species: Mu
Applications: WB, Simple Western, IHC
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-790
Species: Hu, Mu, Po
Applications: WB, IHC-P, PEP-ELISA
NB110-58849
Species: Hu, Mu, Rt, Po, Bv, Pm, Rb, Sh
Applications: WB, IB, ICC/IF, IHC, IHC-Fr, IHC-P
MAB7357
Species: Hu
Applications: WB
NBP2-46085
Species: Hu
Applications: WB, IHC

Publications for DCTN3 Antibody (NBP1-91823) (0)

There are no publications for DCTN3 Antibody (NBP1-91823).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DCTN3 Antibody (NBP1-91823) (0)

There are no reviews for DCTN3 Antibody (NBP1-91823). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for DCTN3 Antibody (NBP1-91823) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for DCTN3 Antibody (NBP1-91823)

Discover related pathways, diseases and genes to DCTN3 Antibody (NBP1-91823). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DCTN3 Antibody (NBP1-91823)

Discover more about diseases related to DCTN3 Antibody (NBP1-91823).

Research Areas for DCTN3 Antibody (NBP1-91823)

Find related products by research area.

Blogs on DCTN3

There are no specific blogs for DCTN3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DCTN3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DCTN3