DCK Antibody (1D12)

Images

 
Immunocytochemistry/ Immunofluorescence: DCK Antibody (1D12) [H00001633-M08] - Analysis of monoclonal antibody to DCK on HeLa cell. Antibody concentration 10 ug/ml
Sandwich ELISA: DCK Antibody (1D12) [H00001633-M08] - Detection limit for recombinant GST tagged DCK is approximately 3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
1D12
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

DCK Antibody (1D12) Summary

Immunogen
DCK (NP_000779 161 a.a. - 260 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. WMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL
Specificity
deoxycytidine kinase
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
DCK
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
Publications
Read Publication using H00001633-M08.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for DCK Antibody (1D12)

  • dCK
  • deoxycytidine kinase
  • EC 2.7.1
  • EC 2.7.1.74
  • MGC117410
  • MGC138632

Background

Deoxycytidine kinase (DCK) is required for the phosphorylation of several deoxyribonucleosides and their nucleoside analogs. Deficiency of DCK is associated with resistance to antiviral and anticancer chemotherapeutic agents. Conversely, increased deoxycytidine kinase activity is associated with increased activation of these compounds to cytotoxic nucleoside triphosphate derivatives. DCK is clinically important because of its relationship to drug resistance and sensitivity.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-39019
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84256
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-57516
Species: Hu
Applications: WB
NBP1-85740
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
MAB6240
Species: Hu
Applications: WB, IHC
NBP2-20626
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-50508
Species: Hu, Mu, Rt
Applications: WB, IHC-P
NBP1-87404
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-15291
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87424
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB5125
Species: Hu, Mu, Rt
Applications: WB, IHC
MAB6727
Species: Hu
Applications: WB
AF6486
Species: Hu
Applications: WB, Simple Western
NBP1-87441
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20231
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20626
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-92505
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-34390
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NBP2-53089
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00006241-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP

Publications for DCK Antibody (H00001633-M08)(1)

Reviews for DCK Antibody (H00001633-M08) (0)

There are no reviews for DCK Antibody (H00001633-M08). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for DCK Antibody (H00001633-M08) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DCK Products

Bioinformatics Tool for DCK Antibody (H00001633-M08)

Discover related pathways, diseases and genes to DCK Antibody (H00001633-M08). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DCK Antibody (H00001633-M08)

Discover more about diseases related to DCK Antibody (H00001633-M08).
 

Pathways for DCK Antibody (H00001633-M08)

View related products by pathway.

PTMs for DCK Antibody (H00001633-M08)

Learn more about PTMs related to DCK Antibody (H00001633-M08).

Blogs on DCK

There are no specific blogs for DCK, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DCK Antibody (1D12) and receive a gift card or discount.

Bioinformatics

Gene Symbol DCK
Entrez
OMIM
Uniprot