DCDC2 Antibody - BSA Free

Western Blot: DCDC2 Antibody [NBP3-35777] - Western blot analysis of various lysates using DCDC2 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 3min.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

DCDC2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit DCDC2 Antibody - BSA Free (NBP3-35777) is a polyclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-250 of human DCDC2 (NP_001182539).
  
  Sequence:
  MSGSSARSSHLSQPVVKSVLVYRNGDPFYAGRRVVIHEKKVSSFEVFLKEVTGGVQAPFGAVRNIYTPRTGHRIRKLDQIQSGGNYVAGGQEAFKKLNYLDIGEIKKRPMEVVNTEVKPVIHSRINVSARFRKPLQEPCTIFLIANGDLINPASRLLIPRKTLNQWDHVLQMVTEKITLRSGAVHRLYTLEGKLVESGAELENGQFYVAVGRDKFKKLPYSELLFDKSTMRRPFGQKASSLPPIVGSRKS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DCDC2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 53 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for DCDC2 Antibody - BSA Free

• DCDC2A
• doublecortin domain containing 2
• KIAA1154Protein RU2S
• RU2doublecortin domain-containing protein 2
• RU2S

Background

The DCDC2 protein has two doublecortin peptide domains. This domain has been demonstrated to bind tubulin and enhance microtubule polymerization. Mutations in the gene encoding DCDC2 have been associated with Reading Disability (RD), also referred to as developmental dyslexia.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DCDC2