DCDC2 Antibody

Images

 
Western Blot: DCDC2 Antibody [NBP1-79649] - Titration: 0.2-1 ug/ml, Positive Control: Mouse Brain.

Product Details

Summary
Reactivity Mu, Hu, Rt, Bv, Ca, Eq, GpSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DCDC2 Antibody Summary

Immunogen
Synthetic peptide directed towards the N terminal of human Dcdc2a. Peptide sequence QIESGGNYVAGGPEAFKKLNYLDIGEIKKRPMEAVNTEVKPVIHSRINVS. The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Human (100%), Rat (100%), Canine (93%), Equine (100%), Guinea Pig (93%), Bovine (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DCDC2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against Dcdc2a and was validated on Western blot.
Theoretical MW
40 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for DCDC2 Antibody

  • DCDC2A
  • doublecortin domain containing 2
  • KIAA1154Protein RU2S
  • RU2doublecortin domain-containing protein 2
  • RU2S

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-93472
Species: Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-68766
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
AF1749
Species: Rt
Applications: WB, IHC
NBP1-57578
Species: Hu
Applications: WB
AF4928
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-88036
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87349
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
NBP2-97473
Species: Hu
Applications: WB, IHC, IHC-P, IP
H00006936-B01P
Species: Hu
Applications: WB, ICC/IF
NBP2-50071
Species: Hu
Applications: Flow, IHC, IHC-P, CyTOF-ready, IF
NBP2-31844
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89985
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-541
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NBP2-56939
Species: Hu
Applications: WB, ICC/IF
NBP1-86892
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-38530
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
7559-ST
Species: Hu

Publications for DCDC2 Antibody (NBP1-79649) (0)

There are no publications for DCDC2 Antibody (NBP1-79649).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DCDC2 Antibody (NBP1-79649) (0)

There are no reviews for DCDC2 Antibody (NBP1-79649). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DCDC2 Antibody (NBP1-79649) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional DCDC2 Products

Bioinformatics Tool for DCDC2 Antibody (NBP1-79649)

Discover related pathways, diseases and genes to DCDC2 Antibody (NBP1-79649). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DCDC2 Antibody (NBP1-79649)

Discover more about diseases related to DCDC2 Antibody (NBP1-79649).
 

Pathways for DCDC2 Antibody (NBP1-79649)

View related products by pathway.

PTMs for DCDC2 Antibody (NBP1-79649)

Learn more about PTMs related to DCDC2 Antibody (NBP1-79649).

Blogs on DCDC2

There are no specific blogs for DCDC2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DCDC2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DCDC2
Uniprot