DC-SCRIPT/ZNF366 Antibody

Images

 
Immunohistochemistry-Paraffin: ZNF366 Antibody [NBP1-81922] - Staining of human bone marrow shows strong nuclear positivity in bone marrow poietic cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DC-SCRIPT/ZNF366 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: STKSEHAPEVLEEACKEEKEDASKGEWEKRSKGDLGAEGGQERDCAGRDECLSLRAFQSTRRGPSFSDYLYFKHRDESLKELLERK
Specificity
Specificity of human DC-SCRIPT/ZNF366 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZNF366
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
DC-SCRIPT/ZNF366 Protein (NBP1-81922PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DC-SCRIPT/ZNF366 Antibody

  • DCSCRIPT
  • DC-SCRIPT
  • FLJ39796
  • zinc finger protein 366
  • ZNF366

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-92684
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
NB300-560
Species: Hu, Mu, Rt, Av, Bv, Pm
Applications: WB, IHC, IHC-Fr, IHC-P, IF
6507-IL/CF
Species: Hu
NBP2-13674
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF5415
Species: Hu
Applications: WB, IHC, ICC
NBP1-88707
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00005555-P01
Species: Hu
NB200-322
Species: Hu, Mu, Rt
Applications: WB, IHC-Fr
NBP1-47492
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-26612
Species: Hu
Applications: IP (-), WB
NBP2-37607
Species: Hu, Rt
Applications: WB, ELISA, IHC
AF2699
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC
NBP2-33600
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49153
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-91073
Species: Hu
Applications: IHC, IHC-P

Publications for DC-SCRIPT/ZNF366 Antibody (NBP1-81922) (0)

There are no publications for DC-SCRIPT/ZNF366 Antibody (NBP1-81922).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DC-SCRIPT/ZNF366 Antibody (NBP1-81922) (0)

There are no reviews for DC-SCRIPT/ZNF366 Antibody (NBP1-81922). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for DC-SCRIPT/ZNF366 Antibody (NBP1-81922) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for DC-SCRIPT/ZNF366 Antibody (NBP1-81922)

Discover related pathways, diseases and genes to DC-SCRIPT/ZNF366 Antibody (NBP1-81922). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DC-SCRIPT/ZNF366 Antibody (NBP1-81922)

Discover more about diseases related to DC-SCRIPT/ZNF366 Antibody (NBP1-81922).
 

Pathways for DC-SCRIPT/ZNF366 Antibody (NBP1-81922)

View related products by pathway.

Blogs on DC-SCRIPT/ZNF366

There are no specific blogs for DC-SCRIPT/ZNF366, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DC-SCRIPT/ZNF366 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF366