DBR1 Antibody (3A7) - Azide and BSA Free

Western Blot: DBR1 Antibody (3A7) [H00051163-M01] - Analysis of DBR1 expression in transfected 293T cell line by DBR1 monoclonal antibody (M01), clone 3A7.Lane 1: DBR1 transfected lysate(61.6 KDa).Lane 2: Non-transfected lysate.

Immunocytochemistry/Immunofluorescence: DBR1 Antibody (3A7) [H00051163-M01] - Analysis of monoclonal antibody to DBR1 on HeLa cell . Antibody concentration 10 ug/ml.

Sandwich ELISA: DBR1 Antibody (3A7) [H00051163-M01] - Detection limit for recombinant GST tagged DBR1 is 0.03 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, ICC/IF
• Clone: 3A7
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

DBR1 Antibody (3A7) - Azide and BSA Free Summary

• Immunogen: DBR1 (NP_057300.2, 445 a.a. ~ 538 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SGMNTPSVEPSDQASEFSASFSDVRILPGSMIVSSDDTVDSTIDREGKPGGTVESGNGEDLTKVPLKRLSDEHEPEQRKKIKRRNQAIYAAVDD
• Specificity: DBR1 - debranching enzyme homolog 1 (S. cerevisiae) (3A7)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: DBR1
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for DBR1 Antibody (3A7) - Azide and BSA Free

• debranching enzyme (S. Cerevisiae) homolog 1
• debranching enzyme homolog 1 (S. cerevisiae)
• EC 3.1
• lariat debranching enzyme
• RNA lariat debranching enzyme

Background

The RNA lariat debranching enzyme, or DBR1, specifically hydrolyzes 2-prime-to-5-prime branched phosphodiester bonds at the branch point of excised lariat intron RNA and converts them into linear molecules.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DBR1
• Entrez:
  • 51163(Human)
• Uniprot:
  • NP_057300(Human)