Recombinant Human DAB1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human DAB1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-553 of Human DAB1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MSTETELQVAVKTSAKKDSRKKGQDRSEATLIKRFKGEGVRYKAKLIGIDEVSAARGDKLCQDSMMKLKGVVAGARSKGEHKQKIFLTISFGGIKIFDEKTGALQHHHAVHEISYIAKDITDHRAFGYVCGKEGNHRFVAIKTAQAAEPVILDLRDLFQLIYELKQREELEKKAQKDKQCEQAVYQVPTSQKKEGVYDVPKSQPVSNGYSFEDFEERFAAATPNRNLPTDFDEIFEATKAVTQLELFGDMSTPPDITSPPTPATPGDAFIPSSSQTLPASADVFSSVPFGTAAVPSGYVAMGAVLPSFWGQQPLVQQQMVMGAQPPVAQVMPGAQPIAWGQPGLFPATQQPWPTVAGQFPPAAFMPTQTVMPLPAAMFQGPLTPLATVPGTSDSTRSSPQTDKPRQKMGKETFKDFQMAQPPPVPSRKPDQPSLTCTSEAFSSYFNKVGVAQDTDDCDDFDISQLNLTPVTSTTPSTNSPPTPAPRQSSPSKSSASHASDPTTDDIFEEGFESPSKSEEQEAPDGSQASSNSDPFGEPSGEPSGDNISPQAGS

Protein/Peptide Type
Recombinant Protein
Gene
DAB1

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human DAB1 Protein

  • disabled (Drosophila) homolog 1
  • disabled homolog 1 (Drosophila)
  • disabled homolog 1

Background

The laminar organization of multiple neuronal types in the cerebral cortex is required for normal cognitive function. In mice, the disabled-1 gene plays a central role in brain development, directing the migration of cortical neurons past previously formed neurons to reach their proper layer. This gene is similar to disabled-1, and the protein encoded by this gene is thought to be a signal transducer that interacts with protein kinase pathways to regulate neuronal positioning in the developing brain. Alternatively spliced transcript variants of this gene have been reported, but their full length nature has not been determined. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-1081
Species: Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-78162
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2216
Species: Hu, Mu, Ch
Applications: WB, ICC/IF, PAGE
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NBP2-15843
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB500-517
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF7250
Species: Hu
Applications: IHC
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF2428
Species: Hu
Applications: WB
NBP1-89530
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF3770
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP1-87769
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92564
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91931
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00001600-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for DAB1 Recombinant Protein (H00001600-P01) (0)

There are no publications for DAB1 Recombinant Protein (H00001600-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DAB1 Recombinant Protein (H00001600-P01) (0)

There are no reviews for DAB1 Recombinant Protein (H00001600-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DAB1 Recombinant Protein (H00001600-P01). (Showing 1 - 1 of 1 FAQ).

  1. I am interested in the recombinant protein dab1 (H00001600-P01). Does it corresponds to the full length protein?
    • H00001600-P01 is human DAB1 full-length ORF (AAH67445.1, 1 a.a. - 553 a.a.) recombinant protein with GST-tag at N-terminal. The sequence is as follows: MSTETELQVAVKTSAKKDSRKKGQDRSEATLIKRFKGEGVRYKAKLIGIDEVSAARGDKLCQDSMMKLKGVVAGARSKGEHKQKIFLTISFGGIKIFDEKTGALQHHHAVHEISYIAKDITDHRAFGYVCGKEGNHRFVAIKTAQAAEPVILDLRDLFQLIYELKQREELEKKAQKDKQCEQAVYQVPTSQKKEGVYDVPKSQPVSNGYSFEDFEERFAAATPNRNLPTDFDEIFEATKAVTQLELFGDMSTPPDITSPPTPATPGDAFIPSSSQTLPASADVFSSVPFGTAAVPSGYVAMGAVLPSFWGQQPLVQQQMVMGAQPPVAQVMPGAQPIAWGQPGLFPATQQPWPTVAGQFPPAAFMPTQTVMPLPAAMFQGPLTPLATVPGTSDSTRSSPQTDKPRQKMGKETFKDFQMAQPPPVPSRKPDQPSLTCTSEAFSSYFNKVGVAQDTDDCDDFDISQLNLTPVTSTTPSTNSPPTPAPRQSSPSKSSASHASDPTTDDIFEEGFESPSKSEEQEAPDGSQASSNSDPFGEPSGEPSGDNISPQAGS

Additional DAB1 Products

Bioinformatics Tool for DAB1 Recombinant Protein (H00001600-P01)

Discover related pathways, diseases and genes to DAB1 Recombinant Protein (H00001600-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DAB1 Recombinant Protein (H00001600-P01)

Discover more about diseases related to DAB1 Recombinant Protein (H00001600-P01).
 

Pathways for DAB1 Recombinant Protein (H00001600-P01)

View related products by pathway.

PTMs for DAB1 Recombinant Protein (H00001600-P01)

Learn more about PTMs related to DAB1 Recombinant Protein (H00001600-P01).
 

Research Areas for DAB1 Recombinant Protein (H00001600-P01)

Find related products by research area.

Blogs on DAB1

There are no specific blogs for DAB1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

DAB1 Antibody
NBP2-16095

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human DAB1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol DAB1