Cytosolic Sulfotransferase 4A1/SULT4A1 Antibody - BSA Free

Western Blot: Cytosolic Sulfotransferase 4A1/SULT4A1 Antibody [NBP3-10776] - Western blot analysis of Cytosolic Sulfotransferase 4A1/SULT4A1 in Human Jurkat Whole Cell. Antibody dilution at 1ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Cytosolic Sulfotransferase 4A1/SULT4A1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Cytosolic Sulfotransferase 4A1/SULT4A1 Antibody - BSA Free (NBP3-10776) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human Cytosolic Sulfotransferase 4A1/SULT4A1 (XP_005261572). Peptide sequence ELTSPRLIKSHLPYRFLPSDLHNGDSKVIYMARNPKDLVVSYYQFHRSLR
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SULT4A1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 28 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Cytosolic Sulfotransferase 4A1/SULT4A1 Antibody - BSA Free

• Brain sulfotransferase-like protein
• BRSTL1
• BR-STL-1
• Cytosolic Sulfotransferase 4A1
• EC 2.8.2.-
• hBR-STL
• hBR-STL-1MGC40032
• nervous system cytosolic sulfotransferase
• Nervous system sulfotransferase
• NST
• ST4A1
• sulfotransferase 4A1
• sulfotransferase family 4A, member 1
• sulfotransferase-related protein
• SULT4A1
• SULTX3
• SULTX3DJ388M5.3

Background

The SULT4A1 gene encodes a member of the sulfotransferase family. The encoded protein is a brain-specific sulfotransferase believed to be involved in the metabolism of neurotransmitters. Polymorphisms in this gene may be associated with susceptibility to schizop

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SULT4A1