Cytosolic Sulfotransferase 1C2/SULT1C2 Antibody - BSA Free

Western Blot: Cytosolic Sulfotransferase 1C2/SULT1C2 Antibody [NBP1-53102] - Hela cell lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Cytosolic Sulfotransferase 1C2/SULT1C2 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to SULT1C2(sulfotransferase family, cytosolic, 1C, member 2) The peptide sequence was selected from the C terminal of SULT1C2 (NP_001047). Peptide sequence LDQSISSFMRKGTVGDWKNHFTVAQNERFDEIYRRKMEGTSINFCMEL. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SULT1C2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 35 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Cytosolic Sulfotransferase 1C2/SULT1C2 Antibody - BSA Free

• Cytosolic Sulfotransferase 1C2
• cytosolic, 1C, member 1
• EC 2.8.2
• EC 2.8.2.-
• EC 2.8.2.1
• EC 2.8.2.2
• humSULTC2
• ST1C1
• ST1C2
• Sulfotransferase 1C1
• sulfotransferase family, cytosolic, 1C, member 2
• SULT1C#1
• SULT1C1
• SULT1C2

Background

Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. SULT1C2 is a protein that belongs to the SULT1 subfamily, responsible for transferring a sulfo moiety from PAPS to phenol-containing compounds. Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene encodes a protein that belongs to the SULT1 subfamily, responsible for transferring a sulfo moiety from PAPS to phenol-containing compounds. Two alternatively spliced transcript variants encoding different isoforms have been described for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SULT1C2
• Entrez:
  • 6819(Human)
• Uniprot:
  • O00338(Human)