Cytosolic Sulfotransferase 1C2/SULT1C2 Antibody


Western Blot: Cytosolic Sulfotransferase 1C2/SULT1C2 Antibody [NBP1-53102] - Hela cell lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

Cytosolic Sulfotransferase 1C2/SULT1C2 Antibody Summary

Synthetic peptides corresponding to SULT1C2(sulfotransferase family, cytosolic, 1C, member 2) The peptide sequence was selected from the C terminal of SULT1C2 (NP_001047). Peptide sequence LDQSISSFMRKGTVGDWKNHFTVAQNERFDEIYRRKMEGTSINFCMEL.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.2-1 ug/ml
Theoretical MW
35 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Cytosolic Sulfotransferase 1C2/SULT1C2 Antibody

  • Cytosolic Sulfotransferase 1C2
  • cytosolic, 1C, member 1
  • EC 2.8.2
  • EC 2.8.2.-
  • EC
  • EC
  • humSULTC2
  • ST1C1
  • ST1C2
  • Sulfotransferase 1C1
  • sulfotransferase family, cytosolic, 1C, member 2
  • SULT1C#1
  • SULT1C1
  • SULT1C2


Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. SULT1C2 is a protein that belongs to the SULT1 subfamily, responsible for transferring a sulfo moiety from PAPS to phenol-containing compounds. Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene encodes a protein that belongs to the SULT1 subfamily, responsible for transferring a sulfo moiety from PAPS to phenol-containing compounds. Two alternatively spliced transcript variants encoding different isoforms have been described for this gene.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB

Publications for Cytosolic Sulfotransferase 1C2/SULT1C2 Antibody (NBP1-53102) (0)

There are no publications for Cytosolic Sulfotransferase 1C2/SULT1C2 Antibody (NBP1-53102).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cytosolic Sulfotransferase 1C2/SULT1C2 Antibody (NBP1-53102) (0)

There are no reviews for Cytosolic Sulfotransferase 1C2/SULT1C2 Antibody (NBP1-53102). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cytosolic Sulfotransferase 1C2/SULT1C2 Antibody (NBP1-53102) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Cytosolic Sulfotransferase 1C2/SULT1C2 Products

Bioinformatics Tool for Cytosolic Sulfotransferase 1C2/SULT1C2 Antibody (NBP1-53102)

Discover related pathways, diseases and genes to Cytosolic Sulfotransferase 1C2/SULT1C2 Antibody (NBP1-53102). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cytosolic Sulfotransferase 1C2/SULT1C2 Antibody (NBP1-53102)

Discover more about diseases related to Cytosolic Sulfotransferase 1C2/SULT1C2 Antibody (NBP1-53102).

Pathways for Cytosolic Sulfotransferase 1C2/SULT1C2 Antibody (NBP1-53102)

View related products by pathway.

PTMs for Cytosolic Sulfotransferase 1C2/SULT1C2 Antibody (NBP1-53102)

Learn more about PTMs related to Cytosolic Sulfotransferase 1C2/SULT1C2 Antibody (NBP1-53102).

Blogs on Cytosolic Sulfotransferase 1C2/SULT1C2

There are no specific blogs for Cytosolic Sulfotransferase 1C2/SULT1C2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Cytosolic Sulfotransferase 1C2/SULT1C2 Antibody and receive a gift card or discount.


Gene Symbol SULT1C2