Cytokeratin, HMW Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

Cytokeratin, HMW Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human KRT76.
  
  

  Source: E. coli

  Amino Acid Sequence: SGSGYGGVSSGSTGGRGSSGSYQSSSSGSRLGGAGSISVSHSGMGSSSGSIQTSGGSGYKSGGGGSTSIRFSQTTSSSQHSSTK

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: KRT76
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-81648.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 25 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Cytokeratin, HMW Recombinant Protein Antigen

• CK-2P
• cytokeratin 2
• Cytokeratin-2P
• HUMCYT2A
• K2P
• K76
• keratin 76
• keratin, type II cytoskeletal 2 oral
• keratin-76
• KRT2Bcytokeratin-2P
• KRT2Pkeratin 2p
• KRT76
• Type-II keratin Kb9

Background

KRT76, also known as Keratin, type II cytoskeletal 2 oral, is a 638 amino acid that is approx. 66 kDa, belongs to the intermediate filament family responsible for the structural integrity of epithelial cells, subdivided into epithelial keratins and hair keratins, and probably contributes to terminal cornification. Studies are being performed in relation to this protein and obstructive jaundice, pharyngitis, jaundice, cervical cancer, neuronitis, colorectal cancer, cervicitis, interferon and hepatitis. This protein has been shown to have interactions with ATG13, PDPK1, ULK2, GABARAP, and PRKAA1 in cytoskeleton organization pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: KRT76