Cytokeratin 2 Antibody [HRP]

Product Discontinued

Cytokeratin 2 Antibody [HRP] Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-220 of human Cytokeratin 2 (KRT2) (NP_000414.2).
  
  Sequence:
  MSCQISCKSRGRGGGGGGFRGFSSGSAVVSGGSRRSTSSFSCLSRHGGGGGGFGGGGFGSRSLVGLGGTKSISISVAGGGGGFGAAGGFGGRGGGFGGGSSFGGGSGFSGGGFGGGGFGGGRFGGFGGPGGVGGLGGPGGFGPGGYPGGIHEVSVNQSLLQPLNVKVDPEIQNVKAQEREQIKTLNNKFASFIDKVRFLEQQNQVLQTKWELLQQMNVGT
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KRT2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: PBS
• Preservative: No Preservative
• Purity: Affinity purified

Alternate Names for Cytokeratin 2 Antibody [HRP]

• CK-2e
• cytokeratin-2e
• epidermal ichthyosis bullosa of Siemens
• Epithelial keratin-2e
• K2e
• keratin 2
• keratin 2A (epidermal ichthyosis bullosa of Siemens)
• keratin, type II cytoskeletal 2 epidermal
• Keratin-2 epidermis
• keratin-2e
• KRT2AMGC116967
• KRT2EMGC116968
• KRTE
• Type-II keratin Kb2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KRT2