Cytohesin 2 Antibody (5E11) - Azide and BSA Free

Western Blot: Cytohesin 2 Antibody (5E11) [H00009266-M01] - CYTH2 monoclonal antibody (M01), clone 5E11. Analysis of CYTH2 expression in A-431.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 5E11
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Cytohesin 2 Antibody (5E11) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse Cytohesin 2 Antibody (5E11) - Azide and BSA Free (H00009266-M01) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: CYTH2 (NP_059431, 314 a.a. ~ 398 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VDDPRKPNCFELYIPNNKGQLIKACKTEADGRVVEGNHMVYRISAPTQEEKDEWIKSIQAAVSVDPFYEMLAARKKRISVKKKQE
• Isotype: IgG2b Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: CYTH2
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot
• Application Notes: This antibody is useful for ELISA, Western Blot

Reactivity Notes

This product is reactive against Human.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Cytohesin 2 Antibody (5E11) - Azide and BSA Free

• ARF exchange factor
• ARF nucleotide-binding site opener
• ARNO
• ARNOPH, SEC7 and coiled-coil domain-containing protein 2
• CTS18.1
• CYTH2
• Cytohesin 2
• pleckstrin homology, Sec7 and coiled-coil domains 2 (cytohesin-2)
• Protein ARNO
• PSCD2
• PSCD2L
• PSCD2LCTS18
• PSCD2pleckstrin homology, Sec7 and coiled-coil domains 2
• Sec7 and coiled/coil domains 2 (cytohesin-2)

Background

The protein encoded by this gene is a member of the PSCD family. Members of this family have identical structural organization that consists of an N-terminal coiled-coil motif, a central Sec7 domain, and a C-terminal pleckstrin homology (PH) domain. The coiled-coil motif is involved in homodimerization, the Sec7 domain contains guanine-nucleotide exchange protein (GEP) activity, and the PH domain interacts with phospholipids and is responsible for association of PSCDs with membranes. Members of this family appear to mediate the regulation of protein sorting and membrane trafficking. The encoded protein exhibits GEP activity in vitro with ARF1, ARF3, and ARF6 and is 83% homologous to CYTH1. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CYTH2
• Uniprot:
  • NP_059431(Human)