Cystatin-8 Antibody - BSA Free Summary
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 53-142 of human CST8 (NP_005483.1). MQEYNKESEDKYVFLVVKTLQAQLQVTNLLEYLIDVEIARSDCRKPLSTNEICAIQENSKLKRKLSCSFLVGALPWNGEFTVMEKKCEDA |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
CST8 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Western Blot 1:500 - 1:2000
|
| Theoretical MW |
16 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Cystatin-8 Antibody - BSA Free
Background
Cystatin 8, also referred to as CST8, has a 142 amino acid isoform that is 16 kDa, and is involved in reproduction, especially pertaining to sperm development and maturation. Disease research is being conducted between Cystatin 8 and several diseases and disorders to determine the relation between the two. Some of these disorders include epididymitis, cerebral hemorrhage, melanoma, t-cell leukemia, cerebritis, and choriocarcinoma. This protein is not linked to any pathways, and is not known to interact with any other proteins at this time.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Mu, Rt
Applications: ELISA
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: ICC, IP, WB
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Bv, Gt, Hu, Po, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: WB
Species: Hu, Mu
Applications: ELISA, IHC
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Mu
Applications: WB
Publications for Cystatin-8 Antibody (NBP2-92605) (0)
There are no publications for Cystatin-8 Antibody (NBP2-92605).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Cystatin-8 Antibody (NBP2-92605) (0)
There are no reviews for Cystatin-8 Antibody (NBP2-92605).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Cystatin-8 Antibody (NBP2-92605) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Cystatin-8 Products
Research Areas for Cystatin-8 Antibody (NBP2-92605)
Find related products by research area.
|
Blogs on Cystatin-8