cystatin 11 Antibody

Images

 
Immunohistochemistry: cystatin 11 Antibody [NBP2-31559] - Staining of human epididymis shows strong membranous positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

cystatin 11 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: YQARKKTFLSVHEVMAVENYAKDSLQWITDQYNKESDDKYHFRIFRV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CST11
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
cystatin 11 Protein (NBP2-31559PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for cystatin 11 Antibody

  • CST11
  • CST8L
  • CTES2
  • Cystatin-11
  • Cystatin-Related Epididymal-Specific Protein
  • DJ322G13.6
  • SC13
  • SC13delta

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-47219
Species: Hu
Applications: WB, PEP-ELISA
NBL1-09552
Species: Hu
NBP1-85431
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85565
Species: Hu
Applications: IHC, IHC-P
NBP1-86617
Species: Hu
Applications: ICC/IF, IHC, IHC-P, ICC
NBL1-16115
Species: Hu
NBP2-37463
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
AF4928
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-31559
Species: Hu
Applications: IHC, IHC-P

Publications for cystatin 11 Antibody (NBP2-31559) (0)

There are no publications for cystatin 11 Antibody (NBP2-31559).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for cystatin 11 Antibody (NBP2-31559) (0)

There are no reviews for cystatin 11 Antibody (NBP2-31559). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for cystatin 11 Antibody (NBP2-31559) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional cystatin 11 Products

Bioinformatics Tool for cystatin 11 Antibody (NBP2-31559)

Discover related pathways, diseases and genes to cystatin 11 Antibody (NBP2-31559). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on cystatin 11

There are no specific blogs for cystatin 11, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our cystatin 11 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CST11
Uniprot