Cystatin-8 Antibody - BSA Free

Western Blot: Cystatin-8 Antibody [NBP2-92605] - Analysis of extracts of various cell lines, using Cystatin-8 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.

• Reactivity: Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Cystatin-8 Antibody - BSA Free Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 53-142 of human CST8 (NP_005483.1). MQEYNKESEDKYVFLVVKTLQAQLQVTNLLEYLIDVEIARSDCRKPLSTNEICAIQENSKLKRKLSCSFLVGALPWNGEFTVMEKKCEDA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CST8
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 16 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Cystatin-8 Antibody - BSA Free

• CRESCystatin-related epididymal spermatogenic protein
• cystatin 8 (cystatin-related epididymal specific)
• cystatin-8
• cystatin-related epididymal-specific

Background

Cystatin 8, also referred to as CST8, has a 142 amino acid isoform that is 16 kDa, and is involved in reproduction, especially pertaining to sperm development and maturation. Disease research is being conducted between Cystatin 8 and several diseases and disorders to determine the relation between the two. Some of these disorders include epididymitis, cerebral hemorrhage, melanoma, t-cell leukemia, cerebritis, and choriocarcinoma. This protein is not linked to any pathways, and is not known to interact with any other proteins at this time.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CST8