Cystatin-8 Antibody

Images

 
Western Blot: Cystatin-8 Antibody [NBP1-57663] - THP-1 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Cystatin-8 Antibody Summary

Immunogen
Synthetic peptides corresponding to CST8(cystatin 8 (cystatin-related epididymal specific)) The peptide sequence was selected from the middle region of CST8. Peptide sequence LKPVNASNANVKQCLWFAMQEYNKESEDKYVFLVVKTLQAQLQVTNLLEY.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CST8
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against CST8 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Cystatin-8 Antibody

  • CRESCystatin-related epididymal spermatogenic protein
  • cystatin 8 (cystatin-related epididymal specific)
  • cystatin-8
  • cystatin-related epididymal-specific

Background

The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions. The cystatin locus on chromosome 20 contains the majority of the type 2 cystatin genes and pseudogenes. This gene is located in the cystatin locus and encodes a protein similar to type 2 cystatins. The protein exhibits highly tissue-specific expression in the reproductive tract, suggesting implicit roles in reproduction. Alternative splicing identified in mouse is suggested in human based on EST evidence but the full-length nature of putative variants has not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00128821-P01
Species: Hu
AF6018
Species: Hu, Mu
Applications: WB, IP, ICC
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-52432
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC
NBP1-86616
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-31559
Species: Hu
Applications: IHC, IHC-P
NBP2-38536
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-55298
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-80944
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-14924
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB2380
Species: Hu
Applications: WB
NBP2-05682
Species: Hu
NBP2-14260
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP1-88526
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Cystatin-8 Antibody (NBP1-57663) (0)

There are no publications for Cystatin-8 Antibody (NBP1-57663).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cystatin-8 Antibody (NBP1-57663) (0)

There are no reviews for Cystatin-8 Antibody (NBP1-57663). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cystatin-8 Antibody (NBP1-57663) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Cystatin-8 Antibody (NBP1-57663)

Discover related pathways, diseases and genes to Cystatin-8 Antibody (NBP1-57663). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cystatin-8 Antibody (NBP1-57663)

Discover more about diseases related to Cystatin-8 Antibody (NBP1-57663).
 

Pathways for Cystatin-8 Antibody (NBP1-57663)

View related products by pathway.

PTMs for Cystatin-8 Antibody (NBP1-57663)

Learn more about PTMs related to Cystatin-8 Antibody (NBP1-57663).

Blogs on Cystatin-8

There are no specific blogs for Cystatin-8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cystatin-8 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CST8
Uniprot