Cyr61/CCN1 Recombinant Protein Antigen

Product Discontinued

Cyr61/CCN1 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CYR61.
  
  

  Source: E. coli

  Amino Acid Sequence: CGCCKVCAKQLNEDCSKTQPCDHTKGLECNFGASSTALKGICRAQSEGRPCEYNSRIYQNGESFQPNCKHQCTCIDGAV

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: CCN1
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86573.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 26 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Cyr61/CCN1 Recombinant Protein Antigen

• CCN family member 1
• CCN1
• CCN1IGF-binding protein 10
• Cyr61
• Cysteine-rich angiogenic inducer 61
• cysteine-rich, angiogenic inducer, 61
• GIG1
• GIG1cysteine-rich heparin-binding protein 61
• IBP-10
• IGFBP-10
• IGFBP10cysteine-rich, anigogenic inducer, 61
• Insulin-like growth factor-binding protein 10
• protein CYR61
• Protein GIG1

Background

CYR61 (Cysteine-rich angiogenic inducer 61) is a 381 amino acid secreted protein. It promotes cell proliferation, chemotaxis, angiogenesis extracellular matrix formation and cell adhesion and this appears to make CYR61 play a role in wound healing in skin fibroblasts. CYR61 expression is induced by growth factors. It interacts with several integrins and with heparan sulfate proteoglycan. CYR61 may play a role in T-cell non-Hodgkin's disease, breast cancer, epithelial neoplasia, hepatocellular carcinoma, ischemia, gastric cancer, endometriosis, prostate carcinoma, prostatitis, prostate cancer, breast carcinoma, cardiomyopathy, melanoma and adenocarcinoma.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: CCN1