Cyr61/CCN1 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CYR61. Source: E. coli
Amino Acid Sequence: CGCCKVCAKQLNEDCSKTQPCDHTKGLECNFGASSTALKGICRAQSEGRPCEYNSRIYQNGESFQPNCKHQCTCIDGAV Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
CCN1 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86573. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
26 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for Cyr61/CCN1 Recombinant Protein Antigen
Background
CYR61 (Cysteine-rich angiogenic inducer 61) is a 381 amino acid secreted protein. It promotes cell proliferation, chemotaxis, angiogenesis extracellular matrix formation and cell adhesion and this appears to make CYR61 play a role in wound healing in skin fibroblasts. CYR61 expression is induced by growth factors. It interacts with several integrins and with heparan sulfate proteoglycan. CYR61 may play a role in T-cell non-Hodgkin's disease, breast cancer, epithelial neoplasia, hepatocellular carcinoma, ischemia, gastric cancer, endometriosis, prostate carcinoma, prostatitis, prostate cancer, breast carcinoma, cardiomyopathy, melanoma and adenocarcinoma.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, WB
Species: Hu, Mu
Applications: ICC, IHC, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ELISA, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu, Mu, Rt
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Hu
Applications: AdBlk, CyTOF-ready, Flow, ICC, IP
Species: Mu
Applications: ELISA
Species: Hu
Applications: ICC, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ICC, IHC, WB
Species: Hu
Applications: AC
Publications for Cyr61/CCN1 Protein (NBP1-86573PEP) (0)
There are no publications for Cyr61/CCN1 Protein (NBP1-86573PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Cyr61/CCN1 Protein (NBP1-86573PEP) (0)
There are no reviews for Cyr61/CCN1 Protein (NBP1-86573PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for Cyr61/CCN1 Protein (NBP1-86573PEP) (0)
Additional Cyr61/CCN1 Products
Research Areas for Cyr61/CCN1 Protein (NBP1-86573PEP)
Find related products by research area.
|
Blogs on Cyr61/CCN1