Cyr61/CCN1 Antibody

Immunohistochemistry-Paraffin: Cyr61/CCN1 Antibody [NBP1-86573] - Staining of human cervix, uterine shows cytoplasmic positivity in squamous epithelial cells.

Immunohistochemistry-Paraffin: Cyr61/CCN1 Antibody [NBP1-86573] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Immunohistochemistry-Paraffin: Cyr61/CCN1 Antibody [NBP1-86573] - Staining of human cervix, uterine shows weak to moderate cytoplasmic positivity in squamous epithelial cells.

Product Discontinued

Cyr61/CCN1 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: CGCCKVCAKQLNEDCSKTQPCDHTKGLECNFGASSTALKGICRAQSEGRPCEYNSRIYQNGESFQPNCKHQCTCIDGAV
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CCN1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: IHC reported in scientific literature (PMID: 26681917). For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 26681917).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Cyr61/CCN1 Antibody

• CCN family member 1
• CCN1
• CCN1IGF-binding protein 10
• Cyr61
• Cysteine-rich angiogenic inducer 61
• cysteine-rich, angiogenic inducer, 61
• GIG1
• GIG1cysteine-rich heparin-binding protein 61
• IBP-10
• IGFBP-10
• IGFBP10cysteine-rich, anigogenic inducer, 61
• Insulin-like growth factor-binding protein 10
• protein CYR61
• Protein GIG1

Background

CYR61 (Cysteine-rich angiogenic inducer 61) is a 381 amino acid secreted protein. It promotes cell proliferation, chemotaxis, angiogenesis extracellular matrix formation and cell adhesion and this appears to make CYR61 play a role in wound healing in skin fibroblasts. CYR61 expression is induced by growth factors. It interacts with several integrins and with heparan sulfate proteoglycan. CYR61 may play a role in T-cell non-Hodgkin's disease, breast cancer, epithelial neoplasia, hepatocellular carcinoma, ischemia, gastric cancer, endometriosis, prostate carcinoma, prostatitis, prostate cancer, breast carcinoma, cardiomyopathy, melanoma and adenocarcinoma.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Cyr61/CCN1 Antibody (NBP1-86573)(1)

Publication using NBP1-86573

• Li X, Pishdari B, Cui P et al. Regulation of Androgen Receptor Expression Alters AMPK Phosphorylation in the Endometrium: In Vivo and In Vitro Studies in Women with Polycystic Ovary Syndrome. Int J Biol Sci 2015-11-01 [PMID: 26681917] (IF/IHC, Human)

Bioinformatics

• Gene Symbol: CCN1