CYP4Z1 Antibody

Product Discontinued

CYP4Z1 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:STLDSYLKAVFNLSKISNQRMNNFLHHNDLVFKFSSQGQIFSKFNQELHQFTEKVIQDRKESLKDKLKQDTTQKRR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CYP4Z1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for CYP4Z1 Antibody

• CYP4A20
• CYPIVZ1
• cytochrome P450 4Z1
• cytochrome P450, family 4, subfamily Z, polypeptide 1
• EC 1.14.14.1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CYP4Z1 Antibody (NBP1-91817)(3)

Publications using NBP1-91817

• Al-Saraireh YM, Alshammari FOFO, Youssef AMM Et al. Cytochrome 4Z1 Expression is Associated with Poor Prognosis in Colon Cancer Patients OncoTargets and therapy 2021-11-12 [PMID: 34803385] (IHC-P, Human)
• Al-Saraireh YM, Alshammari FOFO, Youssef AMM Et al. Cytochrome 4Z1 Expression is Associated with Unfavorable Survival in Triple-Negative Breast Cancers Breast cancer (Dove Medical Press) 2021-10-05 [PMID: 34675653] (IHC-P, Human)
• Al-saraireh Y, Alboaisa N, Alrawashdeh H et al. Screening of cytochrome 4Z1 expression in human non-neoplastic, pre-neoplastic and neoplastic tissues ecancer 2020-09-29 [PMID: 33144882] (IHC-P, Human)

Bioinformatics

• Gene Symbol: CYP4Z1