CYP4X1 Antibody

Images

 
Western Blot: CYP4X1 Antibody [NBP1-62382] - PANC1 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CYP4X1 Antibody Summary

Immunogen
Synthetic peptides corresponding to CYP4X1(cytochrome P450, family 4, subfamily X, polypeptide 1) The peptide sequence was selected from the middle region of CYP4X1. Peptide sequence LDIVLSAKDESGSSFSDIDVHSEVSTFLLAGHDTLAASISWILYCLALNP.
Clonality
Polyclonal
Host
Rabbit
Gene
CYP4X1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against CYP4X1 and was validated on Western blot.

The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Theoretical MW
59 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for CYP4X1 Antibody

  • CYPIVX1
  • cytochrome P450 4X1
  • cytochrome P450, family 4, subfamily X, polypeptide 1
  • EC 1.14.14.1
  • MGC40051

Background

The specific function of the protein remains unknown.This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. The expression pattern of a similar rat protein suggests that this protein may be involved in neurovascular function in the brain.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-30522
Species: Hu
Applications: IHC, IHC-P
NBP1-85361
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-50215
Species: Hu
Applications: WB, ELISA, IHC
NBP2-24722
Species: Hu
Applications: WB, IHC-P
NBP2-30043
Species: Hu
Applications: WB, ICC/IF, IHC-P
NBP1-83659
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86142
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-37502
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP2-50204
Species: Hu, Mu
Applications: WB, ELISA, IHC
NBP2-16061
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00002166-M07
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP2-02563
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-74398
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01488
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-86461
Species: Hu
Applications: WB, IHC, IHC-P
H00005980-A01
Species: Hu
Applications: WB, ELISA
NBP2-30566
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-56928
Species: Hu
Applications: WB, ICC/IF
NBP2-16064
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-62382
Species: Hu
Applications: WB

Publications for CYP4X1 Antibody (NBP1-62382) (0)

There are no publications for CYP4X1 Antibody (NBP1-62382).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CYP4X1 Antibody (NBP1-62382) (0)

There are no reviews for CYP4X1 Antibody (NBP1-62382). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CYP4X1 Antibody (NBP1-62382) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CYP4X1 Antibody Products

Related Products by Gene

Bioinformatics Tool for CYP4X1 Antibody (NBP1-62382)

Discover related pathways, diseases and genes to CYP4X1 Antibody (NBP1-62382). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CYP4X1 Antibody (NBP1-62382)

Discover more about diseases related to CYP4X1 Antibody (NBP1-62382).
 

Pathways for CYP4X1 Antibody (NBP1-62382)

View related products by pathway.

PTMs for CYP4X1 Antibody (NBP1-62382)

Learn more about PTMs related to CYP4X1 Antibody (NBP1-62382).

Blogs on CYP4X1

There are no specific blogs for CYP4X1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CYP4X1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CYP4X1
Uniprot

Customers Who Bought This Also Bought