CYFIP2 Antibody (4G6) - Azide and BSA Free

Western Blot: CYFIP2 Antibody (4G6) [H00026999-M01] - Analysis of CYFIP2 expression in transfected 293T cell line by CYFIP2 monoclonal antibody (M01), clone 4G6.Lane 1: CYFIP2 transfected lysate(145.7 KDa).Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 4G6
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

CYFIP2 Antibody (4G6) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse CYFIP2 Antibody (4G6) - Azide and BSA Free (H00026999-M01) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: CYFIP2 (NP_055191, 733 a.a. ~ 820 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. YGVIIPYPPSNRYETLLKQRHVQLLGRSIDLNRLITQRISAAMYKSLDQAISRFESEDLTSIVELEWLLEINRLTHRLLCKHMTLDSF
• Specificity: cytoplasmic FMR1 interacting protein 2
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: CYFIP2
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactive against recombinant protein on ELISA. It has also been used for Western Blot.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CYFIP2 Antibody (4G6) - Azide and BSA Free

• cytoplasmic FMR1 interacting protein 2
• cytoplasmic FMR1-interacting protein 2
• KIAA1168
• p53 inducible protein
• PIR121p53-inducible protein 121

Background

CYFIP2, also known as Cytoplasmic FMR1-interacting protein 2, includes a 148 kDa and a 146 kDa isoform, and is involved in the initiation of apoptosis and T-cell adhesion. Disease research is currently being conducted to determine the relationship between CYFIP2 and multiple sclerosis, gout, and asthma. The protein has been linked to the Rac1 Pathway, ErbB1 downstream signaling, regulation of actin cytoskeleton, and the immune system. In these pathways and biological processes, CYFIP2 interacts with ABI1, FXR1, GAS7, FXR2, and ABI3.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CYFIP2
• Entrez:
  • 26999(Human)
• OMIM:
  • 606323(Human)
• Uniprot:
  • NP_055191(Human)