Cyclophilin-E Antibody

Images

 
Western Blot: Cyclophilin-E Antibody [NBP1-85365] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate ...read more
Immunohistochemistry: Cyclophilin-E Antibody [NBP1-85365] - Staining of human cerebellum shows strong nuclear positivity.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Cyclophilin-E Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EEVDDKVLHAAFIPFGDITDIQIPLDYETEKHRGFAFVEFELAEDAAAAIDNMNESELFGRTIRVNLAKPMRIKEGSSRPVWSDDDWLKKF
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PPIE
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Cyclophilin-E Protein (NBP1-85365PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Cyclophilin-E Antibody

  • Cyclophilin E
  • cyclophilin-33
  • CYP33
  • CyP-33
  • EC 5.2.1.8
  • MGC111222
  • MGC3736
  • peptidyl-prolyl cis-trans isomerase E
  • peptidylprolyl isomerase E (cyclophilin E)
  • PPIase E
  • Rotamase E

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3589
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NB600-248
Species: Hu
Applications: WB, IP
NBP2-57062
Species: Hu
Applications: WB, ICC/IF
NBP2-38604
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB3777
Species: Hu, Mu, Rt
Applications: WB
NBP1-88766
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14016
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85921
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13794
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38905
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56340
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
H00002288-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P, IP
AF4094
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP1-87929
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF4174
Species: Hu, Mu, Rt
Applications: WB, Simple Western
NBP1-85360
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83889
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83887
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-52085
Species: Hu, Mu
Applications: WB, PEP-ELISA
NBP2-24633
Species: Hu, Mu, Rt, Ch, Fe, Pm
Applications: WB

Publications for Cyclophilin-E Antibody (NBP1-85365) (0)

There are no publications for Cyclophilin-E Antibody (NBP1-85365).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cyclophilin-E Antibody (NBP1-85365) (0)

There are no reviews for Cyclophilin-E Antibody (NBP1-85365). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cyclophilin-E Antibody (NBP1-85365) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Cyclophilin-E Products

Bioinformatics Tool for Cyclophilin-E Antibody (NBP1-85365)

Discover related pathways, diseases and genes to Cyclophilin-E Antibody (NBP1-85365). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cyclophilin-E Antibody (NBP1-85365)

Discover more about diseases related to Cyclophilin-E Antibody (NBP1-85365).
 

Pathways for Cyclophilin-E Antibody (NBP1-85365)

View related products by pathway.

PTMs for Cyclophilin-E Antibody (NBP1-85365)

Learn more about PTMs related to Cyclophilin-E Antibody (NBP1-85365).

Blogs on Cyclophilin-E

There are no specific blogs for Cyclophilin-E, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cyclophilin-E Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PPIE