Cyclophilin-E Antibody

Western Blot: Cyclophilin-E Antibody [NBP1-85365] - Analysis in control (vector only transfected HEK293T lysate) and PPIE over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: Cyclophilin-E Antibody [NBP1-85365] - Staining of human cerebellum shows strong nuclear positivity.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

Cyclophilin-E Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: EEVDDKVLHAAFIPFGDITDIQIPLDYETEKHRGFAFVEFELAEDAAAAIDNMNESELFGRTIRVNLAKPMRIKEGSSRPVWSDDDWLKKF
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PPIE
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Cyclophilin-E Protein (NBP1-85365PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Cyclophilin-E Antibody

• Cyclophilin E
• cyclophilin-33
• CYP33
• CyP-33
• EC 5.2.1.8
• MGC111222
• MGC3736
• peptidyl-prolyl cis-trans isomerase E
• peptidylprolyl isomerase E (cyclophilin E)
• PPIase E
• Rotamase E

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PPIE