Cyclophilin A Antibody - BSA Free

Western Blot: Cyclophilin A Antibody [NBP1-54388] - Sample Tissue: Human HepG2 Antibody Dilution: 1.0 ug/ml

Immunohistochemistry-Paraffin: Cyclophilin A Antibody [NBP1-54388] - Human Intestine Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Epithelial cells of intestinal villus (indicated with arrows) 400X magnification.

Western Blot: Cyclophilin A Antibody [NBP1-54388] - HepG2 cell lysate, Antibody Titration: 2.5ug/ml

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 1 mg/ml

Cyclophilin A Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to PPIA(peptidylprolyl isomerase A (cyclophilin A)) The peptide sequence was selected from the middle region of PPIA. Peptide sequence TAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PPIA
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 4-8 ug/ml
  • Western Blot 1.0 ug/ml
• Theoretical MW: 18 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 1 mg/ml
• Purity: Protein A purified

Alternate Names for Cyclophilin A Antibody - BSA Free

• Cyclophilin A
• Cyclosporin A-binding protein
• CYPA
• CYPAMGC12404
• CYPH
• EC 5.2.1.8
• MGC117158
• MGC23397
• peptidyl-prolyl cis-trans isomerase A
• peptidylprolyl isomerase A (cyclophilin A)
• PPIA
• PPIase A
• Rotamase A
• Rotamase
• T cell cyclophilin

Background

PPIA is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. PPIA is a cyclosporin binding-protein and may play a role in cyclosporin A-mediated immunosuppression. The protein can also interact with several HIV proteins, including p55 gag, Vpr, and capsid protein, and has been shown to be necessary for the formation of infectious HIV virions.The protein encoded by this gene is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein is a cyclosporin binding-protein. It may play a role in cyclosporin A-mediated immunosuppression. This protein can interact with several HIV proteins including p55 gag, Vpr, and capsid protein. It has been shown to be necessary for the formation of infectious HIV virions. Multiple pseudogenes that map to different chromosomes have been reported. Three alternatively spliced transcript variants encoding two distinct isoforms have been observed.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Cyclophilin A Antibody (NBP1-54388)(1)

Publication using NBP1-54388

• Yamamoto T, Kudo M, Peng WX et al. Identification of aldolase A as a potential diagnostic biomarker for colorectal cancer based on proteomic analysis using formalin-fixed paraffin-embedded tissue. Tumour Biol. 2016-07-28 [PMID: 27468721] (IF/IHC)

Bioinformatics

• Gene Symbol: PPIA
• Entrez:
  • 5478(Human)
• Uniprot:
  • P62937()