CTPS2 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

CTPS2 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CTPS2
  
  

  Source: E. coli

  Amino Acid Sequence: RVPVLLEEQSIVKYFKERLHLPIGDSASNLLFKWRNMADRYERLQKICSIA

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: CTPS2
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10-100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55881.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

  For further blocking peptide related information and a protocol, click here.

• Theoretical MW: 24 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for CTPS2 Recombinant Protein Antigen

• CTP synthase 2
• CTP synthase II
• CTP synthetase 2
• CTP synthetase isoform
• CTP synthetase type 2
• cytidine 5'-triphosphate synthetase 2
• DKFZp686C17207
• EC 6.3.4.2
• FLJ43358
• MGC32997
• UTP--ammonia ligase 2
• UTP-ammonia ligase

Background

The protein encoded by the CTPS2 gene catalyzes the formation of CTP from UTP with the concomitant deamination of glutamineto glutamate. This protein is the rate-limiting enzyme in the synthesis of cytosine nucleotides, which play animportant role in various metabolic processes and provide the precursors necessary for the synthesis of RNA and DNA.Cancer cells that exhibit increased cell proliferation also exhibit an increased activity of this encoded protein.Thus, this protein is an attractive target for selective chemotherapy. Three alternatively spliced transcript variantsencoding the same protein have been described for this gene. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CTPS2