CTPS2 Recombinant Protein Antigen

Images

 
There are currently no images for CTPS2 Recombinant Protein Antigen (NBP3-17826PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

CTPS2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CTPS2

Source: E. coli

Amino Acid Sequence: RVPVLLEEQSIVKYFKERLHLPIGDSASNLLFKWRNMADRYERLQKICSIA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CTPS2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17826.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CTPS2 Recombinant Protein Antigen

  • CTP synthase 2
  • CTP synthase II
  • CTP synthetase 2
  • CTP synthetase isoform
  • CTP synthetase type 2
  • cytidine 5'-triphosphate synthetase 2
  • DKFZp686C17207
  • EC 6.3.4.2
  • FLJ43358
  • MGC32997
  • UTP--ammonia ligase 2
  • UTP-ammonia ligase

Background

The protein encoded by the CTPS2 gene catalyzes the formation of CTP from UTP with the concomitant deamination of glutamineto glutamate. This protein is the rate-limiting enzyme in the synthesis of cytosine nucleotides, which play animportant role in various metabolic processes and provide the precursors necessary for the synthesis of RNA and DNA.Cancer cells that exhibit increased cell proliferation also exhibit an increased activity of this encoded protein.Thus, this protein is an attractive target for selective chemotherapy. Three alternatively spliced transcript variantsencoding the same protein have been described for this gene. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-52892
Species: Hu
Applications: IHC,  IHC-P, WB
H00004810-M05
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP1-81838
Species: Hu
Applications: IHC,  IHC-P, WB
NLS830
Species: Bt, Ca, Eq, Hu, Pm, Po, Pm, Rb
Applications: IHC,  IHC-P, WB
NBP2-93674
Species: Hu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-20541
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-31851
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP3-05584
Species: Mu, Rt
Applications: WB
NBP1-80891
Species: Hu
Applications: IHC,  IHC-P
NBP1-87691
Species: Hu
Applications: IHC,  IHC-P, WB
AF3320
Species: Hu
Applications: IHC, Simple Western, WB
H00008833-M01
Species: Hu
Applications: ELISA, Flow, IHC,  IHC-P, S-ELISA, WB
NBP3-27151
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-85014
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-13199
Species: Hu
Applications: IHC, WB
NBP3-17826PEP
Species: Hu
Applications: AC

Publications for CTPS2 Recombinant Protein Antigen (NBP3-17826PEP) (0)

There are no publications for CTPS2 Recombinant Protein Antigen (NBP3-17826PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CTPS2 Recombinant Protein Antigen (NBP3-17826PEP) (0)

There are no reviews for CTPS2 Recombinant Protein Antigen (NBP3-17826PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CTPS2 Recombinant Protein Antigen (NBP3-17826PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CTPS2 Products

Research Areas for CTPS2 Recombinant Protein Antigen (NBP3-17826PEP)

Find related products by research area.

Blogs on CTPS2

There are no specific blogs for CTPS2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CTPS2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CTPS2