CTHRC1 Antibody (1G12)

Images

 
Western Blot: CTHRC1 Antibody (1G12) [H00115908-M05] - Analysis of CTHRC1 expression in transfected 293T cell line by CTHRC1 monoclonal antibody (M05), clone 1G12. Lane 1: CTHRC1 transfected lysatE (26.2 KDa). Lane 2: ...read more
Immunohistochemistry-Paraffin: CTHRC1 Antibody (1G12) [H00115908-M05] - Analysis of monoclonal antibody to CTHRC1 on formalin-fixed paraffin-embedded human kidney. Antibody concentration 3 ug/ml
ELISA: CTHRC1 Antibody (1G12) [H00115908-M05] - Detection limit for recombinant GST tagged CTHRC1 is 0.03 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC, IHC-P, S-ELISA
Clone
1G12
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

CTHRC1 Antibody (1G12) Summary

Immunogen
CTHRC1 (NP_612464, 32 a.a. ~ 141 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EIPKGKQKAQLRQREVVDLYNGMCLQGPAGVPGRDGSPGANGIPGTPGIPGRDGFKGEKGECLRESFEESWTPNYKQCSWSSLNYGIDLGKIAECTFTKMRSNSALRVLF
Specificity
CTHRC1 - collagen triple helix repeat containing 1 (1G12)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CTHRC1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
Application Notes
Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Publications
Read Publication using H00115908-M05.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CTHRC1 Antibody (1G12)

  • collagen triple helix repeat containing 1
  • collagen triple helix repeat-containing protein 1
  • CTHRC1
  • NMTC1
  • Protein NMTC1

Background

CTHRC1 is specifically expressed in vascular calcifications of carotid artery lesions and may contribute to vascular remodeling of injured arteries (Pyagay et al., 2005 [PubMed 15618538]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1526
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-30042
Species: Hu, Mu, Rt, Ch, Rb
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, KO
NB100-1514
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, PEP-ELISA
AF2064
Species: Hu
Applications: WB, Simple Western
NB600-594
Species: Hu, Mu, Rt, Bv, Fe
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
AF6278
Species: Hu, Mu
Applications: WB
NBP2-24519
Species: Hu, Mu, Rt, Bv, Ca, Ch, Eq, Pm
Applications: WB
AF1927
Species: Hu
Applications: WB, IP, ICC
AF7164
Species: Hu
Applications: WB
2980-PI
Species: Hu
AF3797
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC
AF2396
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-24648
Species: Hu, Mu, Rt, Pm
Applications: WB
NB100-56649
Species: Hu
Applications: WB, ICC/IF, Flow-IC
H00115908-M05
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA

Publications for CTHRC1 Antibody (H00115908-M05)(1)

Reviews for CTHRC1 Antibody (H00115908-M05) (0)

There are no reviews for CTHRC1 Antibody (H00115908-M05). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CTHRC1 Antibody (H00115908-M05) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional CTHRC1 Products

Bioinformatics Tool for CTHRC1 Antibody (H00115908-M05)

Discover related pathways, diseases and genes to CTHRC1 Antibody (H00115908-M05). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CTHRC1 Antibody (H00115908-M05)

Discover more about diseases related to CTHRC1 Antibody (H00115908-M05).
 

Pathways for CTHRC1 Antibody (H00115908-M05)

View related products by pathway.

PTMs for CTHRC1 Antibody (H00115908-M05)

Learn more about PTMs related to CTHRC1 Antibody (H00115908-M05).

Blogs on CTHRC1

There are no specific blogs for CTHRC1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CTHRC1 Antibody (1G12) and receive a gift card or discount.

Bioinformatics

Gene Symbol CTHRC1
Entrez
Uniprot