CST9L Antibody - BSA Free Summary
| Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human CST9L. Peptide sequence ILLIYAWHFHEQRDCDEHNVMARYLPATVEFAVHTFNQQSKDYYAYRLGH |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
CST9L |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Theoretical MW |
16 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for CST9L Antibody - BSA Free
Background
The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members areactive cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. Thereare three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and thekininogens. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of humanfluids and secretions. The cystatin locus on chromosome 20 contains the majority of the type 2 cystatin genes andpseudogenes. This gene is located in the cystatin locus and encodes a protein similar to mouse cystatin 9. Based onits testis-specific expression, it is likely to have a role in tissue reorganization during early testis development.(provided by RefSeq)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: PEP-ELISA, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: ELISA, IHC
Species: Mu, Rt
Applications: ELISA
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
Species: Pm, Hu
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC, IHC, WB
Species: Hu
Applications: ICC, Simple Western, WB
Species: Hu, Mu, Pm, Rb, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: WB
Publications for CST9L Antibody (NBP3-10654) (0)
There are no publications for CST9L Antibody (NBP3-10654).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for CST9L Antibody (NBP3-10654) (0)
There are no reviews for CST9L Antibody (NBP3-10654).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for CST9L Antibody (NBP3-10654) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional CST9L Products
Blogs on CST9L