CSE1L/CAS/Exportin-2 Antibody (1E4.)

Images

 
Western Blot: CSE1L/CAS/Exportin-2 Antibody (1E4) [H00001434-M02] - CSE1L monoclonal antibody (M02), clone 1E4 Analysis of CSE1L expression in K-562.
Immunocytochemistry/ Immunofluorescence: CSE1L/CAS/Exportin-2 Antibody (1E4) [H00001434-M02] - Analysis of monoclonal antibody to CSE1L on HeLa cell. Antibody concentration 10 ug/ml.
Sandwich ELISA: CSE1L/CAS/Exportin-2 Antibody (1E4) [H00001434-M02] - Detection limit for recombinant GST tagged CSE1L is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
1E4.
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

CSE1L/CAS/Exportin-2 Antibody (1E4.) Summary

Immunogen
CSE1L (NP_001307 872 a.a. - 971 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LIGLFELPEDDTIPDEEHFIDIEDTPGYQTAFSQLAFAGKKEHDPVGQMVNNPKIHLAQSLHKLSTACPGRVPSMVSTSLNAEALQYLQGYLQAARVTLL
Specificity
CSE1L - CSE1 chromosome segregation 1-like (yeast)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CSE1L
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CSE1L/CAS/Exportin-2 Antibody (1E4.)

  • CAS
  • CASMGC117283
  • Cellular apoptosis susceptibility protein
  • chromosome segregation 1 (yeast homolog)-like
  • Chromosome segregation 1-like protein
  • CSE1 chromosome segregation 1-like (yeast)
  • CSE1
  • CSE1L
  • exp2
  • exportin-2
  • Importin-alpha re-exporter
  • MGC130037
  • XPO2
  • XPO2MGC130036

Background

Proteins that carry a nuclear localization signal (NLS) are transported into the nucleus by the importin-alpha/beta heterodimer. Importin-alpha binds the NLS, while importin-beta mediates translocation through the nuclear pore complex. After translocation, RanGTP binds importin-beta and displaces importin-alpha. Importin-alpha must then be returned to the cytoplasm, leaving the NLS protein behind. The protein encoded by this gene binds strongly to NLS-free importin-alpha, and this binding is released in the cytoplasm by the combined action of RANBP1 and RANGAP1. In addition, the encoded protein may play a role both in apoptosis and in cell proliferation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-46231
Species: Hu
Applications: WB, IHC
AF4478
Species: Hu
Applications: WB, IHC
H00005670-T01
Species: Hu
NBP2-45923
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00532
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-82455
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-58200
Species: Hu, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38206
Species: Hu
Applications: WB, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
AF4259
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-44192
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-22449
Species: Hu, Mu, Rt, Fe, GP, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, GS

Publications for CSE1L/CAS/Exportin-2 Antibody (H00001434-M02) (0)

There are no publications for CSE1L/CAS/Exportin-2 Antibody (H00001434-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CSE1L/CAS/Exportin-2 Antibody (H00001434-M02) (0)

There are no reviews for CSE1L/CAS/Exportin-2 Antibody (H00001434-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CSE1L/CAS/Exportin-2 Antibody (H00001434-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CSE1L/CAS/Exportin-2 Products

Bioinformatics Tool for CSE1L/CAS/Exportin-2 Antibody (H00001434-M02)

Discover related pathways, diseases and genes to CSE1L/CAS/Exportin-2 Antibody (H00001434-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CSE1L/CAS/Exportin-2 Antibody (H00001434-M02)

Discover more about diseases related to CSE1L/CAS/Exportin-2 Antibody (H00001434-M02).
 

Pathways for CSE1L/CAS/Exportin-2 Antibody (H00001434-M02)

View related products by pathway.

PTMs for CSE1L/CAS/Exportin-2 Antibody (H00001434-M02)

Learn more about PTMs related to CSE1L/CAS/Exportin-2 Antibody (H00001434-M02).
 

Research Areas for CSE1L/CAS/Exportin-2 Antibody (H00001434-M02)

Find related products by research area.

Blogs on CSE1L/CAS/Exportin-2

There are no specific blogs for CSE1L/CAS/Exportin-2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CSE1L/CAS/Exportin-2 Antibody (1E4.) and receive a gift card or discount.

Bioinformatics

Gene Symbol CSE1L
Entrez
OMIM
Uniprot