CSB Antibody

Western Blot: CSB Antibody [NBP3-03839] - Western blot analysis of extracts of various cell lines, using CSB antibody (NBP3-03839) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.

Immunohistochemistry-Paraffin: CSB Antibody [NBP3-03839] - Immunohistochemistry of paraffin-embedded human tonsil using CSB Rabbit pAb (NBP3-03839) at dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Western Blot: CSB Antibody [NBP3-03839] - Western blot analysis of extracts of various cell lines, using CSB antibody (NBP3-03839) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.

Immunohistochemistry-Paraffin: CSB Antibody [NBP3-03839] - Immunohistochemistry of paraffin-embedded human colon carcinoma using CSB Rabbit pAb (NBP3-03839) at dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Product Discontinued

CSB Antibody Summary

• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 700-800 of human CSB (NP_000115.1). LPVFMEQFSVPITMGGYSNASPVQVKTAYKCACVLRDTINPYLLRRMKSDVKMSLSLPDKNEQVLFCRLTDEQHKVYQNFVDSKEVYRILNGEMQIFSGLI
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ERCC6
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 168 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS with 50% glycerol, pH7.3.
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for CSB Antibody

• ARMD5
• ATP-dependent helicase ERCC6
• CKN2
• Cockayne syndrome group B protein
• Cockayne syndrome protein CSB
• COFS
• COFS1
• CSBCockayne syndrome B protein
• DNA excision repair protein ERCC-6
• EC 3.6.1
• EC 3.6.4.-
• excision repair cross-complementing rodent repair deficiency, complementationgroup 6
• Rad26 homolog
• RAD26

Background

ERCC6, also known as Cockayne syndrome B protein, is involved in DNA repair in response to UV exposure. ERCC6 has been reported to display ATPase and helicase activity and functions as a transcriptional regulator. Mutations in ERCC6 are the cause of Cockayne syndrome type B (CSB), cerebro-oculo-facio-skeletal syndrome type 1 (COFS1), De Sanctis-Cacchione syndrome (DCS), age-related macular degeneration type 5 (ARMD5), and UV-sensitive syndrome (UVS).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ERCC6