CRY1 Antibody - Azide and BSA Free Summary
Description |
Quality control test: Antibody reactive against mammalian transfected lysate. |
Immunogen |
CRY1 (NP_004066.1, 1 a.a. - 586 a.a.) full-length human protein. MGVNAVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFAGSSNVGINRWRFLLQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKKLATEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLISKMEPLEIPVETITSEVIEKCTTPLSDDHDEKYGVPSLEELGFDTDGLSSAVWPGGETEALTRLERHLERKAWVANFERPRMNANSLLASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLLWREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFHCYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMVNHAEASRLNIERMKQIYQQLSRYRGLGLLASVPSNPNGNGGFMGYSAENIPGCSSSGSCSQGSGILHYAHGDSQQTHLLKQGRSSMGTGLSGGKRPSQEEDTQSIGPKVQRQSTN |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Mouse |
Gene |
CRY1 |
Purity |
Protein G purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/ Immunofluorescence
- Western Blot
|
Application Notes |
It has been used for WB. |
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.4) |
Preservative |
No Preservative |
Purity |
Protein G purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for CRY1 Antibody - Azide and BSA Free
Background
Various biochemical, physiological and behavioural processes display circadian rhythms controlled by an internal biological clock. The central "gears" driving this clock appear to be composed of an autoregulatory transcription/posttranslation-based feedback loop. Cryptochrome 1 (CRY1) and 2 (CRY2) are DNA-binding flavoproteins that bear some homology to blue-light receptors and photolyases. In Drosophila, CRY is a photoreceptor for the circadian clock where it binds to the clock component TIM in a light-dependent fashion and blocks its function. Mammalian Cryptochrome 1 and Cryptochrome 2 function via light-independent interactions with circadian genes CLOCK and BMAL1, as well as with PER1, PER2, and TIM. They seem to act as light-independent components of the circadian clock and probably regulate Per1 transcriptional cycling via interactions with both the activator and its feedback inhibitors. Mutant mice not expressing the Cryptochrome 1 or Cryptochrome 2 protein display accelerated and delayed periodicity of locomotor activity, respectively. It appears that the combination of both proteins working together is essential to synchronize the organism to circadian phases. A critical balance between Cryptochrome 1 and Cryptochrome 2 is required for proper clock function; in complete darkness, double-mutant mice present with instantaneous arrhythmicity, indicating the absence of an internal circadian clock.
Cryptochromes (Cry 1 and 2) are blue, ultraviolet-A photoreceptor pigment proteins that are involved circadian rhythm regulation in plants and animals. In mammals, Cry 1 and 2 expression oscillates with respect to the daily light-dark cycle in the suprachiasmatic nucleus of the hypothalamus. These proteins localize to the cell nucleus, interact with each of the Per proteins, and assist in the translocation of Per from the cytoplasm to nucleus.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Bv, Ca, Eq, Hu, Mu, Pm
Applications: IB, IHC, IHC-P, KO, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: ChIP, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, WB
Species: Eq, Hu, Mu, Rt
Applications: IHC, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, PLA, WB
Species: Hu
Applications: Flow, ICC/IF, PEP-ELISA
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Rt
Applications: WB
Species: Hu
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ChIP, CHIP-SEQ, ChIP, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
Publications for Cryptochrome I Antibody (H00001407-B01P) (0)
There are no publications for Cryptochrome I Antibody (H00001407-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Cryptochrome I Antibody (H00001407-B01P) (0)
There are no reviews for Cryptochrome I Antibody (H00001407-B01P).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Cryptochrome I Antibody (H00001407-B01P) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional CRY1 Products
Research Areas for Cryptochrome I Antibody (H00001407-B01P)
Find related products by research area.
|
Blogs on CRY1