Recombinant Human CROP Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human CROP Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 79 of Human CROP full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MISAAQLLDELMGRDRNLAPDEKRSNVRWDHESVCKYYLCGFCPAELFTNTRSDLDVFGRGDNISDVSKFLEDDKWMEE

Protein/Peptide Type
Recombinant Protein
Gene
LUC7L3

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CROP Protein

  • cAMP regulatory element-associated protein 1
  • cisplatin resistance associated overexpressed protein
  • cisplatin resistance-associated overexpressed protein
  • Cisplatin resistance-associated-overexpressed protein
  • CREAP1
  • CREAP-1LUC7ACRA
  • CRE-associated protein 1
  • CROPFLJ11063
  • hLuc7A
  • Luc7A
  • LUC7-like 3 (S. cerevisiae)
  • luc7-like protein 3
  • O48
  • OA48-18
  • Okadaic acid-inducible phosphoprotein OA48-18

Background

This gene encodes a cisplatin resistance-associated overexpressed protein (CROP). The N-terminal half of the CROP contains cysteine/histidine motifs and leucine zipper-like repeats, and the C-terminal half is rich in arginine and glutamate residues (RE domain) and arginine and serine residues (RS domain). This protein localizes with a speckled pattern in the nucleus, and could be involved in the formation of splicesome via the RE and RS domains. Two alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1481
Species: Hu
Applications: WB, PEP-ELISA
NBP2-29617
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
H00054922-B01P
Species: Hu, Mu
Applications: WB, ELISA
AF5739
Species: Hu, Mu, Rt
Applications: WB
NB100-65214
Species: Hu, Mu, Rt, Ma
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
AF1936
Species: Hu
Applications: WB, IP
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-22553
Species: Hu
Applications: WB, ELISA
NBP2-07799
Species: Hu
NBP1-35703
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-32390
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00051747-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for CROP Recombinant Protein (H00051747-P01) (0)

There are no publications for CROP Recombinant Protein (H00051747-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CROP Recombinant Protein (H00051747-P01) (0)

There are no reviews for CROP Recombinant Protein (H00051747-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CROP Recombinant Protein (H00051747-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CROP Products

Bioinformatics Tool for CROP Recombinant Protein (H00051747-P01)

Discover related pathways, diseases and genes to CROP Recombinant Protein (H00051747-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CROP Recombinant Protein (H00051747-P01)

Discover more about diseases related to CROP Recombinant Protein (H00051747-P01).
 

Pathways for CROP Recombinant Protein (H00051747-P01)

View related products by pathway.

Research Areas for CROP Recombinant Protein (H00051747-P01)

Find related products by research area.

Blogs on CROP

There are no specific blogs for CROP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

CROP Antibody
NBP1-88053
IL-4 [Unconjugated]
204-IL-010/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CROP Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol LUC7L3