CRMP2 Antibody (1F11)

Images

 
Immunocytochemistry/ Immunofluorescence: CRMP2 Antibody (1F11) [H00001808-M01] - Analysis of monoclonal antibody to DPYSL2 on HeLa cell. Antibody concentration 10 ug/ml.
Sandwich ELISA: CRMP2 Antibody (1F11) [H00001808-M01] - Detection limit for recombinant GST tagged DPYSL2 is 0.03 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
1F11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

CRMP2 Antibody (1F11) Summary

Immunogen
DPYSL2 (NP_001377.1 470 a.a. - 571 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PRKPFPDFVYKRIKARSRLAELRGVPRGLYDGPVCEVSVTPKTVTPASSAKTSPAKQQAPPVRNLHQSGFSLSGAQIDDNIPRRTTQRIVAPPGGRANITSL
Specificity
Reacts with dihydropyrimidinase-like 2.
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
DPYSL2
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
This antibody is reactive against recombinant protein in WB and ELISA.
Control
CRMP2 Knockout HeLa Cell Lysate
Publications
Read Publication using H00001808-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CRMP2 Antibody (1F11)

  • Collapsin response mediator protein 2
  • CRMP-2
  • CRMP2N2A3
  • DHPRP2
  • dihydropyrimidinase-like 2 long form
  • dihydropyrimidinase-like 2
  • dihydropyrimidinase-related protein 2
  • DRP2collapsin response mediator protein hCRMP-2
  • DRP-2ULIP-2
  • ULIP2
  • Unc-33-like phosphoprotein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85447
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84074
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-15843
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-75449
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-33419
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47470
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-89953
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
H00002023-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-13913
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67360
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-13937
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-155
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-25162
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
NBP2-02477
Species: Hu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-58359
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-25160
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq
Applications: WB, ICC/IF, IHC
NBP1-91744
Species: Hu
Applications: IHC, IHC-P
NBP1-85224
Species: Hu
Applications: WB, IHC, IHC-P
H00001808-M01
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for CRMP2 Antibody (H00001808-M01)(1)

Reviews for CRMP2 Antibody (H00001808-M01) (0)

There are no reviews for CRMP2 Antibody (H00001808-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CRMP2 Antibody (H00001808-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional CRMP2 Products

Array H00001808-M01

Bioinformatics Tool for CRMP2 Antibody (H00001808-M01)

Discover related pathways, diseases and genes to CRMP2 Antibody (H00001808-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CRMP2 Antibody (H00001808-M01)

Discover more about diseases related to CRMP2 Antibody (H00001808-M01).
 

Pathways for CRMP2 Antibody (H00001808-M01)

View related products by pathway.

PTMs for CRMP2 Antibody (H00001808-M01)

Learn more about PTMs related to CRMP2 Antibody (H00001808-M01).
 

Research Areas for CRMP2 Antibody (H00001808-M01)

Find related products by research area.

Blogs on CRMP2

There are no specific blogs for CRMP2, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CRMP2 Antibody (1F11) and receive a gift card or discount.

Bioinformatics

Gene Symbol DPYSL2
Entrez
Uniprot
COVID-19 update