CRLR Antibody - BSA Free

Western Blot: CALCRL Antibody [NBP1-59073] - Human Fetal Muscle lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu, Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

CRLR Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to CALCRL(calcitonin receptor-like) The peptide sequence was selected from the N terminal of CALCRL. Peptide sequence DGNWFRHPASNRTWTNYTQCNVNTHEKVKTALNLFYLTIIGHGLSIASLL. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CALCRL
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Reactivity Notes

Use in Mouse reported in scientific literature (PMID:35115501).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for CRLR Antibody - BSA Free

• calcitonin gene-related peptide type 1 receptor
• calcitonin receptor-like
• CALCRL
• CGRP type 1 receptor
• CGRPR
• CGRPRCRLRCalcitonin receptor-like receptor
• CRLR

Background

CALCRL is the receptor for calcitonin-gene-related peptide (CGRP) together with RAMP1 and receptor for adrenomedullin together with RAMP2 or RAMP3. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CRLR Antibody (NBP1-59073)(1)

Publication using NBP1-59073

• De Logu F, Nassini R, Hegron A Et al. CGRP Signals from Endosomes of Schwann Cells to Elicit Migraine Pain Nat Commun 2022-02-04 [PMID: 35115501] (WB, Mouse)

FAQs for CRLR Antibody (NBP1-59073). (Showing 1 - 2 of 2 FAQ).

1. I'd like to know if this antibody CALCRL Antibody (NBP1-59073) is indeed against the calcitonin gene-related peptide receptor in human, mouse and rat. I'm not familiar with the short form in your description and just like to be sure.
   • This antibody has been validated for use in detecting CALCRL in human mouse and rat. CALCRL is the same as calcitonin gene-related peptide receptor. Please see https://www.uniprot.org/uniprotkb/Q16602/entry for more information.
2. Please, I need the concentration of the current lot of this Ab: CALCRL Antibody (NBP1-59073).
   • This product is lyophilized. We suggest reconstituting to 1mg/mL.

Bioinformatics

• Gene Symbol: CALCRL
• Uniprot:
  • Q16602()