CRHR2/CRF2 Recombinant Protein Antigen

Images

 
There are currently no images for CRHR2/CRF2 Protein (NBP2-13875PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

CRHR2/CRF2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CRHR2.

Source: E. coli

Amino Acid Sequence: PCPEYFNGVKYNTTRNAYRECLENGTWASKINYSQCEPILDDKQRKYDLHYR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CRHR2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-13875.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CRHR2/CRF2 Recombinant Protein Antigen

  • corticotropin releasing hormone receptor 2
  • corticotropin-releasing factor receptor 2
  • Corticotropin-releasing hormone receptor 2
  • CRF2
  • CRF2R
  • CRFR2
  • CRF-R2
  • CRF-R-2
  • CRFR-2
  • CRF-RB
  • CRH2R
  • CRHR2
  • CRH-R2
  • CRH-R-2
  • HM-CRF

Background

Official Gene Symbol: CRHR2 Gen Bank Accession Number: NP_001874 Gene ID: 1395 (Human) Gene Map Locus: 7p15.1 (Human) CRHR2 is a novel member of Secretin-family-GPCR proteins that functions as a functional receptor for CRF. It is expressed as 3 isoforms; alpha, beta and gamma. These isoforms primarily differ in their N-terminal sequence and tissue distribution. Apart from CRF, other ligands of CRHR2 include UcnI, UcnII and UcnIII. CRHR2 is involved in stress responses, cardiovascular function and gastric motility. Studies on CRHR2 deficient mice suggested a central anxiolytic effect of CRHR2. Northern Blot analysis detects CRHR2 expression in brain, hypothalamus, heart, GI, lung, skeletal muscle and vasculature.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00001392-M02
Species: Hu
Applications: ELISA, IHC,  IHC-P, S-ELISA, WB
NBP1-00175
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, PEP-ELISA, Simple Western, WB
9134-TN
Species: Hu
Applications: BA
MAB7447
Species: Hu
Applications: IHC, WB
NBP3-12450
Species: Hu, Mu
Applications: ELISA, IHC,  IHC-P, WB
NB100-93444
Species: Hu
Applications: PEP-ELISA, WB
NB100-1533
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
H00001392-M02
Species: Hu
Applications: ELISA, IHC,  IHC-P, S-ELISA, WB
7570-GH
Species: Hu
Applications: EnzAct
DYC1825-2
Species: Hu, Mu, Rt
Applications: ELISA
NBP3-42365
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
AF2796
Species: Hu
Applications: IHC, WB
MAB1230
Species: Hu, Mu, Rt
Applications: ICC, IHC, KO, Simple Western, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
DVE00
Species: Hu
Applications: ELISA

Publications for CRHR2/CRF2 Protein (NBP2-13875PEP) (0)

There are no publications for CRHR2/CRF2 Protein (NBP2-13875PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CRHR2/CRF2 Protein (NBP2-13875PEP) (0)

There are no reviews for CRHR2/CRF2 Protein (NBP2-13875PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CRHR2/CRF2 Protein (NBP2-13875PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CRHR2/CRF2 Products

Research Areas for CRHR2/CRF2 Protein (NBP2-13875PEP)

Find related products by research area.

Blogs on CRHR2/CRF2

There are no specific blogs for CRHR2/CRF2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CRHR2/CRF2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CRHR2