Recombinant Human CRHR1/CRF1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human CRHR1/CRF1 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-98 of Human CRHR1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:SLQDQHCESLSLASNISGLQCNASVDLIGTCWPRSPAGQLVVRPCPAFFYGVRYNTTNNGYRECLANGSWAARVNYSECQEILNEEKKSKVHYHVAVI

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
CRHR1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Publications
Read Publication using H00001394-Q01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CRHR1/CRF1 Protein

  • CHR-R1
  • corticotropin releasing hormone receptor 1
  • corticotropin-releasing factor receptor 1
  • corticotropin-releasing factor type 1 receptor
  • Corticotropin-releasing hormone receptor 1
  • CRF1
  • CRFR
  • CRF-R
  • CRFR1
  • CRF-R1
  • CRF-R-1
  • CRFR-1
  • CRHR1
  • CRH-R-1
  • CRHR1f
  • CRH-R1h
  • CRHR1L
  • CRHRCRH-R1
  • seven transmembrane helix receptor

Background

CRHR1 - corticotropin releasing hormone receptor 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-35703
Species: Hu, Mu
Applications: WB, IHC, IHC-P
9134-TN
Species: Hu
NB100-56485
Species: Hu, Mu, Rt, Bv, Ca, Ch
Applications: WB, Simple Western
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
MAB7447
Species: Hu
Applications: WB, IHC
7570-GH
Species: Hu
NBP2-57622
Species: Hu
Applications: WB, ICC/IF, IHC-P
NBP1-35703
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP1-80732
Species: Hu
Applications: IHC, IHC-P
NB100-65214
Species: Hu, Mu, Rt, Ma
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF2796
Species: Hu
Applications: WB, IHC
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-16684
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-46535
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, IHC, IHC-Fr, IHC-P
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
AF245
Species: Hu
Applications: WB, Flow, CyTOF-ready

Publications for CRHR1/CRF1 Partial Recombinant Protein (H00001394-Q01)(1)

Reviews for CRHR1/CRF1 Partial Recombinant Protein (H00001394-Q01) (0)

There are no reviews for CRHR1/CRF1 Partial Recombinant Protein (H00001394-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CRHR1/CRF1 Partial Recombinant Protein (H00001394-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CRHR1/CRF1 Products

Bioinformatics Tool for CRHR1/CRF1 Partial Recombinant Protein (H00001394-Q01)

Discover related pathways, diseases and genes to CRHR1/CRF1 Partial Recombinant Protein (H00001394-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CRHR1/CRF1 Partial Recombinant Protein (H00001394-Q01)

Discover more about diseases related to CRHR1/CRF1 Partial Recombinant Protein (H00001394-Q01).
 

Pathways for CRHR1/CRF1 Partial Recombinant Protein (H00001394-Q01)

View related products by pathway.

PTMs for CRHR1/CRF1 Partial Recombinant Protein (H00001394-Q01)

Learn more about PTMs related to CRHR1/CRF1 Partial Recombinant Protein (H00001394-Q01).
 

Research Areas for CRHR1/CRF1 Partial Recombinant Protein (H00001394-Q01)

Find related products by research area.

Blogs on CRHR1/CRF1

There are no specific blogs for CRHR1/CRF1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

BDNF [Unconjugated]
248-BD-005/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CRHR1/CRF1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CRHR1
Entrez