CPXCR1 Antibody

Images

 
Western Blot: CPXCR1 Antibody [NBP1-80386] - Titration: 1 ug/ml Positive Control: Fetal Brain Lysate.
Immunohistochemistry: CPXCR1 Antibody [NBP1-80386] - Analysis of human thymus after heat-induced Antigen retrieval. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: CPXCR1 Antibody [NBP1-80386] - Human Tymus Tissue, 10ug/ml.
Immunohistochemistry: CPXCR1 Antibody [NBP1-80386] - Analysis of human testis after heat-induced Antigen retrieval. Antibody concentration 10 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CPXCR1 Antibody Summary

Immunogen
Synthetic peptide directed towards the middle region of human CPXCR1. Peptide sequence WANQLAAVAAGARVAGTQACATETIDTSRVSLRAPQEFMTSHSEAGSRIV.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CPXCR1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against CPXCR1 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for CPXCR1 Antibody

  • CPX chromosomal region candidate gene 1 protein
  • CPX chromosome region, candidate 1
  • CT77Cancer/testis antigen 77

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-77847
Species: Hu, Mu, Rt
Applications: WB, ChIP, ELISA, IHC, IHC-P, IP
NBP2-03754
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP2-56444
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81293
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-31622
Species: Hu
Applications: IHC, IHC-P
AF4779
Species: Hu
Applications: WB, IHC
NBP1-97512
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-14299
Species: Hu
Applications: IHC, IHC-P
H00008706-P01
Species: Hu
NBP2-67837
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-84210
Species: Hu
Applications: IHC, IHC-P
NBP1-57260
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-53384
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC-P
NBP2-59323
Species: Hu, Rt
Applications: WB, ICC/IF, IHC
NBP2-57614
Species: Hu
Applications: ICC/IF
NB100-74635
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80386
Species: Hu
Applications: WB, IHC, IHC-P

Publications for CPXCR1 Antibody (NBP1-80386) (0)

There are no publications for CPXCR1 Antibody (NBP1-80386).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CPXCR1 Antibody (NBP1-80386) (0)

There are no reviews for CPXCR1 Antibody (NBP1-80386). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CPXCR1 Antibody (NBP1-80386) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for CPXCR1 Antibody (NBP1-80386)

Discover related pathways, diseases and genes to CPXCR1 Antibody (NBP1-80386). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CPXCR1 Antibody (NBP1-80386)

Discover more about diseases related to CPXCR1 Antibody (NBP1-80386).
 

Pathways for CPXCR1 Antibody (NBP1-80386)

View related products by pathway.

PTMs for CPXCR1 Antibody (NBP1-80386)

Learn more about PTMs related to CPXCR1 Antibody (NBP1-80386).

Blogs on CPXCR1

There are no specific blogs for CPXCR1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CPXCR1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CPXCR1
Uniprot