KLHL4 Antibody (4B6)

Images

 
Western Blot: KLHL4 Antibody (4B6) [H00056062-M05] - Analysis of KLHL4 expression in transfected 293T cell line by KLHL4 monoclonal antibody (M05), clone 4B6. Lane 1: KLHL4 transfected lysate (Predicted MW: 80.2 KDa). ...read more
Sandwich ELISA: KLHL4 Antibody (4B6) [H00056062-M05] - Detection limit for recombinant GST tagged KLHL4 is 1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
4B6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

KLHL4 Antibody (4B6) Summary

Immunogen
KLHL4 (NP_061990, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSVSGKKEFDVKQILRLRWRWFSHPFQGSTNTGSCLQQEGYEHRGTPVQGRLKSHSRDRNGLKKSNSPVHHNILAPVPGPAPAHQRAVQNLQQHNLIVHF
Specificity
KLHL4 - kelch-like 4 (Drosophila) (4B6)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
KLHL4
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Sandwich ELISA
Application Notes
Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for KLHL4 Antibody (4B6)

  • kelch (Drosophila)-like 4
  • kelch-like 4 (Drosophila)
  • kelch-like protein 4
  • KHL4
  • KIAA1687DKELCHL

Background

This gene encodes a member of the kelch family of proteins, which are characterized by kelch repeat motifs and a POZ/BTB protein-binding domain. It is thought that kelch repeats are actin binding domains. However, the specific function of this protein has not been determined. Alternative splicing of this gene results in two transcript variants encoding different isoforms. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80386
Species: Hu
Applications: WB, IHC, IHC-P
AF1914
Species: Hu
Applications: WB, Flow, IP, CyTOF-ready
NBP2-01926
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-71695
Species: Hu, Ca, Pm
Applications: WB, Flow, ICC/IF, CyTOF-ready
NBP1-81293
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-92677
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-90824
Species: Hu
Applications: WB, ICC/IF
AF475
Species: Mu
Applications: WB, IHC
NBP1-69571
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-74635
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-97512
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP

Publications for KLHL4 Antibody (H00056062-M05) (0)

There are no publications for KLHL4 Antibody (H00056062-M05).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KLHL4 Antibody (H00056062-M05) (0)

There are no reviews for KLHL4 Antibody (H00056062-M05). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for KLHL4 Antibody (H00056062-M05) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional KLHL4 Products

Bioinformatics Tool for KLHL4 Antibody (H00056062-M05)

Discover related pathways, diseases and genes to KLHL4 Antibody (H00056062-M05). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KLHL4 Antibody (H00056062-M05)

Discover more about diseases related to KLHL4 Antibody (H00056062-M05).

Blogs on KLHL4

There are no specific blogs for KLHL4, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KLHL4 Antibody (4B6) and receive a gift card or discount.

Bioinformatics

Gene Symbol KLHL4
Entrez
Uniprot