CPN2 Recombinant Protein Antigen

Images

 
There are currently no images for CPN2 Protein (NBP1-90873PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

CPN2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CPN2.

Source: E.coli

Amino Acid Sequence: FDTNYNLFNLALHGNPWQCDCHLAYLFNWLQQYTDRLLNIQTYCAGPAYLKGQVVPALNEKQLVCPVTRDHLGFQVTWPDESKAGGSWDLAVQERAARSQCTYSNPEGTVVLACDQAQCRWLNVQLSPWQGSLGLQYNASQEW

Protein/Peptide Type
Recombinant Protein Antigen
Gene
CPN2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-90873.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related protocol, click here.
Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CPN2 Recombinant Protein Antigen

  • ACBP
  • arginine carboxypeptidase (carboxypeptidase N)
  • carboxypeptidase N 83 kDa chain
  • carboxypeptidase N large subunit
  • carboxypeptidase N regulatory subunit
  • carboxypeptidase N subunit 2
  • carboxypeptidase N, polypeptide 2
  • polypeptide 2, 83kD

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-38648
Species: Hu
Applications: WB, IHC, IHC-P
NB100-41398
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
AF3166
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP1-87695
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-57960
Species: Hu
Applications: WB, IHC, IHC-P
PP-N1665-00
Species: Hu
Applications: WB, IHC, IP
NBP1-85958
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-582
Species: Hu, Mu, Rt, Ca, Ch, SyHa, Ha
Applications: WB, Simple Western
NBP2-16708
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-54980
Species: Hu
Applications: WB, ICC/IF
NBP1-90660
Species: Hu
Applications: IHC, IHC-P
NBP2-55940
Species: Hu
Applications: ICC/IF
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for CPN2 Protein (NBP1-90873PEP) (0)

There are no publications for CPN2 Protein (NBP1-90873PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CPN2 Protein (NBP1-90873PEP) (0)

There are no reviews for CPN2 Protein (NBP1-90873PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for CPN2 Protein (NBP1-90873PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CPN2 Products

CPN2 NBP1-90873PEP

Bioinformatics Tool for CPN2 Protein (NBP1-90873PEP)

Discover related pathways, diseases and genes to CPN2 Protein (NBP1-90873PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CPN2 Protein (NBP1-90873PEP)

Discover more about diseases related to CPN2 Protein (NBP1-90873PEP).
 

Pathways for CPN2 Protein (NBP1-90873PEP)

View related products by pathway.

PTMs for CPN2 Protein (NBP1-90873PEP)

Learn more about PTMs related to CPN2 Protein (NBP1-90873PEP).

Blogs on CPN2

There are no specific blogs for CPN2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Albumin Antibody
NB600-41532
CPN2 Antibody
NBP1-90873

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CPN2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CPN2