We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

CPEB1 Recombinant Protein Antigen

Images

 
There are currently no images for CPEB1 Recombinant Protein Antigen (NBP2-56162PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

CPEB1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CPEB1.

Source: E. coli

Amino Acid Sequence: WDNQEAPALSTCSNANIFRRINAILDNSLDFSRVCTTPINRGIHDHLPDFQDSEETVTSRMLFPTSAQESSRGLPDANDLC

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CPEB1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56162.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CPEB1 Recombinant Protein Antigen

  • CPEBCEBP
  • CPE-binding protein 1
  • CPE-BP1
  • cytoplasmic polyadenylation element binding protein 1
  • cytoplasmic polyadenylation element-binding protein 1
  • FLJ13203
  • h-CEBP
  • hCPEB-1
  • MGC34136
  • MGC60106

Background

CPEB1 encodes a member of the cytoplasmic polyadenylation element (CPE) binding protein family. This highly conserved protein binds to a specific RNA sequence called the CPE found in the 3' UTR of some mRNAs. Similar proteins in Xenopus and mouse function to induce cytoplasmic polyadenylation of dormant mRNAs with short polyA tails, resulting in their translation. Members of this protein family regulate translation of cyclin B1 during embryonic cell divisions. Multiple transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3587
Species: Hu
Applications: CyTOF-ready, ICC, IHC, IP, ICFlow, WB
AF6000
Species: Hu, Mu
Applications: IHC, Simple Western, WB
NBP1-86241
Species: Hu
Applications:  IHC-P, WB
NBP2-14243
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
MAB3228
Species: Hu, Mu, Rt
Applications: ICC, KO, WB
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-46321
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-43686
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-93923
Species: Hu, Mu, Rt
Applications: WB
NBP1-85729
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-92754
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NB200-191
Species: Ha, Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NB100-2437
Species: Ca, Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, PCR, PEP-ELISA, WB
NBP1-80468
Species: Hu
Applications: WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NB100-268
Species: Hu, Po
Applications: IP, WB
NBP1-51843
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB

Publications for CPEB1 Recombinant Protein Antigen (NBP2-56162PEP) (0)

There are no publications for CPEB1 Recombinant Protein Antigen (NBP2-56162PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CPEB1 Recombinant Protein Antigen (NBP2-56162PEP) (0)

There are no reviews for CPEB1 Recombinant Protein Antigen (NBP2-56162PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CPEB1 Recombinant Protein Antigen (NBP2-56162PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CPEB1 Products

Research Areas for CPEB1 Recombinant Protein Antigen (NBP2-56162PEP)

Find related products by research area.

Blogs on CPEB1

There are no specific blogs for CPEB1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

DDX6 Antibody
NB200-191

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CPEB1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CPEB1