COX6B1 Antibody - Azide and BSA Free

Western Blot: COX6B1 Antibody [H00001340-B01P] - Analysis of COX6B1 expression in HepG2 .

Immunocytochemistry/Immunofluorescence: COX6B1 Antibody [H00001340-B01P] - Analysis of purified antibody to COX6B1 on HepG2 cell. (antibody concentration 10 ug/ml)

Western Blot: COX6B1 Antibody [H00001340-B01P] - Analysis of COX6B1 expression in transfected 293T cell line by COX6B1 polyclonal antibody. Lane 1: COX6B1 transfected lysate(9.46 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

COX6B1 Antibody - Azide and BSA Free Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: COX6B1 (NP_001854.1, 1 a.a. - 86 a.a.) full-length human protein. MAEDMETKIKNYKTAPFDSRFPNQNQTRNCWQNYLDFHRCQKAMTAKGGDISVCEWYQRVYQSLCPTSWVTDWDEQRAEGTFPGKI
• Specificity: COX6B1 - cytochrome c oxidase subunit Vib polypeptide 1 (ubiquitous),
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: COX6B1
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control. It is also useful for IF.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for COX6B1 Antibody - Azide and BSA Free

• COX VIb-1
• COX6B
• COXG
• COXVIb1
• cytochrome c oxidase subunit 6B1
• Cytochrome c oxidase subunit VIb isoform 1
• cytochrome c oxidase subunit VIb polypeptide 1 (ubiquitous)
• cytochrome c oxidase subunit Vib

Background

Cytochrome c oxidase (COX), the terminal enzyme of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. It is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may be involved in the regulation and assembly of the complex. This nuclear gene encodes subunit VIb. Three pseudogenes COX6BP-1, COX6BP-2 and COX6BP-3 have been found on chromosomes 7, 17 and 22q13.1-13.2, respectively. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: COX6B1
• Entrez:
  • 1340(Human)
• Uniprot:
  • NP_001854.1(Human)