COX6B1 Antibody

Images

 
Western Blot: COX6B1 Antibody [H00001340-B01P] - Analysis of COX6B1 expression in HepG2.
Immunocytochemistry/ Immunofluorescence: COX6B1 Antibody [H00001340-B01P] - Analysis of purified antibody to COX6B1 on HepG2 cell. (antibody concentration 10 ug/ml)
Western Blot: COX6B1 Antibody [H00001340-B01P] - Analysis of COX6B1 expression in transfected 293T cell line by COX6B1 polyclonal antibody. Lane 1: COX6B1 transfected lysate(9.46 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

COX6B1 Antibody Summary

Immunogen
COX6B1 (NP_001854.1, 1 a.a. - 86 a.a.) full-length human protein. MAEDMETKIKNYKTAPFDSRFPNQNQTRNCWQNYLDFHRCQKAMTAKGGDISVCEWYQRVYQSLCPTSWVTDWDEQRAEGTFPGKI
Specificity
COX6B1 - cytochrome c oxidase subunit Vib polypeptide 1 (ubiquitous),
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
COX6B1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control. It is also useful for IF.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for COX6B1 Antibody

  • COX VIb-1
  • COX6B
  • COXG
  • COXVIb1
  • cytochrome c oxidase subunit 6B1
  • Cytochrome c oxidase subunit VIb isoform 1
  • cytochrome c oxidase subunit VIb polypeptide 1 (ubiquitous)
  • cytochrome c oxidase subunit Vib

Background

Cytochrome c oxidase (COX), the terminal enzyme of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. It is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may be involved in the regulation and assembly of the complex. This nuclear gene encodes subunit VIb. Three pseudogenes COX6BP-1, COX6BP-2 and COX6BP-3 have been found on chromosomes 7, 17 and 22q13.1-13.2, respectively. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-30764
Species: Hu
Applications: IHC, IHC-P
NBP1-32550
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-59438
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP2-45645
Species: Hu
Applications: WB, IHC, IF
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB110-39115
Species: Hu, Mu, Rt, Po, Bv, Dr, I, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-98535
Species: Hu
Applications: WB
NBP2-46865
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13865
Species: Hu
Applications: IHC, IHC-P
NBP1-85500
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31112
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89499
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-31703
Species: Hu
Applications: IHC, IHC-P
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP1-80950
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-14694
Species: Hu
Applications: IHC, IHC-P
NBP2-22217
Species: Hu, Mu, Rt(-)
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NBP2-14694
Species: Hu
Applications: IHC, IHC-P
NBP1-82486
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00001340-B01P
Species: Hu
Applications: WB, ICC/IF

Publications for COX6B1 Antibody (H00001340-B01P) (0)

There are no publications for COX6B1 Antibody (H00001340-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for COX6B1 Antibody (H00001340-B01P) (0)

There are no reviews for COX6B1 Antibody (H00001340-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for COX6B1 Antibody (H00001340-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional COX6B1 Products

Bioinformatics Tool for COX6B1 Antibody (H00001340-B01P)

Discover related pathways, diseases and genes to COX6B1 Antibody (H00001340-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for COX6B1 Antibody (H00001340-B01P)

Discover more about diseases related to COX6B1 Antibody (H00001340-B01P).
 

Pathways for COX6B1 Antibody (H00001340-B01P)

View related products by pathway.

PTMs for COX6B1 Antibody (H00001340-B01P)

Learn more about PTMs related to COX6B1 Antibody (H00001340-B01P).

Blogs on COX6B1

There are no specific blogs for COX6B1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our COX6B1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol COX6B1
Entrez
Uniprot