COX4NB Antibody


Immunocytochemistry/ Immunofluorescence: COX4NB Antibody [NBP2-13864] - Immunofluorescent staining of human cell line HEK 293 shows localization to cytosol.
Immunohistochemistry-Paraffin: COX4NB Antibody [NBP2-13864] - Staining of human kidney shows strong cytoplasmic positivity in renal tubules.
Immunocytochemistry/ Immunofluorescence: COX4NB Antibody [NBP2-13864] - Staining of human cell line U-2 OS shows positivity in mitochondria.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

COX4NB Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: VKLTTQAYCKMVLHGAKYPHCAVNGLLVAEKQKPRKEHLPLGGPGAHHTL FVD
Specificity of human COX4NB antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
COX4NB Protein (NBP2-13864PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (83%), Rat (83%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for COX4NB Antibody

  • C16orf2
  • C16orf4
  • chromosome 16 open reading frame 2
  • COX4 neighbor
  • COX4AL
  • FAM158Bchromosome 16 open reading frame 4
  • neighbor of COX4
  • NOC4family with sequence similarity 158, member B
  • Protein FAM158B


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: IP (-), WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu, Ca, Pm
Applications: WB, Flow, ICC/IF
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, CyTOF-ready, ICFlow
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF
Species: Hu
Applications: ICC/IF
Species: Hu
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for COX4NB Antibody (NBP2-13864) (0)

There are no publications for COX4NB Antibody (NBP2-13864).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for COX4NB Antibody (NBP2-13864) (0)

There are no reviews for COX4NB Antibody (NBP2-13864). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for COX4NB Antibody (NBP2-13864) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional COX4NB Products

Bioinformatics Tool for COX4NB Antibody (NBP2-13864)

Discover related pathways, diseases and genes to COX4NB Antibody (NBP2-13864). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for COX4NB Antibody (NBP2-13864)

Find related products by research area.

Blogs on COX4NB

There are no specific blogs for COX4NB, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our COX4NB Antibody and receive a gift card or discount.


Gene Symbol EMC8