We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

COX18 Recombinant Protein Antigen

Images

 
There are currently no images for COX18 Protein (NBP2-30593PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

COX18 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human COX18.

Source: E. coli

Amino Acid Sequence: AYQHYILAKVENLQPEIKTIARHLNQEVAVRANQLGWSKRDARLTYLKNMRRLISELYVRDNC

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
COX18
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-30593.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for COX18 Recombinant Protein Antigen

  • COX18 cytochrome c oxidase assembly homolog (S. cerevisiae)
  • COX18HS
  • Cox18Hs1 protein
  • Cox18Hs2 protein
  • Cox18Hs3 protein
  • Cytochrome c oxidase assembly protein 18
  • FLJ38991
  • MGC126733
  • mitochondrial COX18
  • mitochondrial inner membrane protein COX18
  • OXA1L2

Background

COX18 encodes a cytochrome c oxidase (COX)-assembly protein. The S. cerevisiae Cox18 protein catalyzes the insertion of the Cox2 (MTCO2; MIM 516040) C-terminal tail into the mitochondrial inner membrane, an intermediate step in the assembly of complex IV of the mitochondrial respiratory chain (Sacconi et al., 2005 [PubMed 16212937]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-689
Species: Hu, Rt
Applications: IHC, IHC-Fr,  IHC-P, Simple Western, WB
NB100-56503
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP2-59438
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP2-97443
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP3-47534
Species: Hu, Mu
Applications: ELISA, IHC, WB
NBP1-32550
Species: Hu, Mu, Ze
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP1-82769
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-91886
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-92298
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
H00004212-M01
Species: Hu, Pm, Mu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP3-35454
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-92389
Species: Hu
Applications: IHC,  IHC-P
NBP1-86322
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-97491
Species: Bv, Ca, Ch, Gp, Ha, Hu, Pm, Mu, Po, Rb, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, Simple Western, WB
NB100-136
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-38956
Species: Hu
Applications: ChIP, IHC,  IHC-P, Simple Western, WB
NBP3-35541
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB

Publications for COX18 Protein (NBP2-30593PEP) (0)

There are no publications for COX18 Protein (NBP2-30593PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for COX18 Protein (NBP2-30593PEP) (0)

There are no reviews for COX18 Protein (NBP2-30593PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for COX18 Protein (NBP2-30593PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional COX18 Products

Blogs on COX18

There are no specific blogs for COX18, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our COX18 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol COX18