Recombinant Human COX IV Isoform 2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human COX IV Isoform 2 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 171 of Human COX4I2 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MLPRAAWSLVLRKGGGGRRGMHSSEGTTRGGGKMSPYTNCYAQRYYPMPEEPFCTELNAEEQALKEKEKGSWTQLTHAEKVALYRLQFNETFAEMNRRSNEWKTVMGCVFFFIGFAALVIWWQRVYVFPPKPITLTDERKAQQLQRMLDMKVNPVQGLASRWDYEKKQWKK

Protein/Peptide Type
Recombinant Protein
Gene
COX4I2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human COX IV Isoform 2 Protein

  • COX IV-2
  • COX4
  • COX4-2
  • COX4B
  • COX4-I2
  • COX4L2
  • COXIV-2
  • cytochrome c oxidase subunit 4 isoform 2, mitochondrial
  • cytochrome c oxidase subunit IV isoform 2 (lung)
  • Cytochrome c oxidase subunit IV isoform 2
  • cytochrome c oxidase subunit IV-like 2
  • dJ857M17.2

Background

Cytochrome c oxidase (COX), the terminal enzyme of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. It is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may be involved in the regulation and assembly of the complex. This nuclear gene encodes isoform 2 of subunit IV. Isoform 1 of subunit IV is encoded by a different gene, however, the two genes show a similar structural organization. Subunit IV is the largest nuclear encoded subunit which plays a pivotal role in COX regulation. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-32550
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30764
Species: Hu
Applications: IHC, IHC-P
NB110-39115
Species: Hu, Mu, Rt, Po, Bv, Dr, I, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-59438
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP1-85500
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP2-19586
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-89499
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-49533
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-31112
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NB400-114
Species: Hu, Mu, Rt, Po, Ch, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-89843
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-04676
Species: Hu, Mu, Rt, Ha, Sq
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP
MAB5564
Species: Hu
Applications: WB, Simple Western
NBP1-71648
Species: Hu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-13865
Species: Hu
Applications: IHC, IHC-P
NBP1-98535
Species: Hu
Applications: WB
NBP2-46865
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for COX IV Isoform 2 Recombinant Protein (H00084701-P01) (0)

There are no publications for COX IV Isoform 2 Recombinant Protein (H00084701-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for COX IV Isoform 2 Recombinant Protein (H00084701-P01) (0)

There are no reviews for COX IV Isoform 2 Recombinant Protein (H00084701-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for COX IV Isoform 2 Recombinant Protein (H00084701-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional COX IV Isoform 2 Products

Bioinformatics Tool for COX IV Isoform 2 Recombinant Protein (H00084701-P01)

Discover related pathways, diseases and genes to COX IV Isoform 2 Recombinant Protein (H00084701-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for COX IV Isoform 2 Recombinant Protein (H00084701-P01)

Discover more about diseases related to COX IV Isoform 2 Recombinant Protein (H00084701-P01).
 

Pathways for COX IV Isoform 2 Recombinant Protein (H00084701-P01)

View related products by pathway.

PTMs for COX IV Isoform 2 Recombinant Protein (H00084701-P01)

Learn more about PTMs related to COX IV Isoform 2 Recombinant Protein (H00084701-P01).
 

Research Areas for COX IV Isoform 2 Recombinant Protein (H00084701-P01)

Find related products by research area.

Blogs on COX IV Isoform 2

There are no specific blogs for COX IV Isoform 2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human COX IV Isoform 2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol COX4I2
Entrez