COPS8 Antibody - BSA Free

Immunohistochemistry-Paraffin: COPS8 Antibody [NBP3-10615] - Immunohistochemical analysis of formalin-fixed paraffin-embedded human liver tissue.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

COPS8 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit COPS8 Antibody - BSA Free (NBP3-10615) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human COPS8 (NP_006701). Peptide sequence TRMVLPRKPVAGALDVSFNKFIPLSEPAPVPPIPNEQQLARLTDYVAFLE
• Clonality: Polyclonal
• Host: Rabbit
• Gene: COPS8
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml
• Theoretical MW: 23 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for COPS8 Antibody - BSA Free

• COP9 constitutive photomorphogenic homolog subunit 8 (Arabidopsis)
• COP9 homolog
• COP9 signalosome complex subunit 8
• COP9
• CSN8JAB1-containing signalosome subunit 8
• hCOP9
• MGC1297
• MMMEP
• SGN8MGC43256
• Signalosome subunit 8

Background

COPS8 is encoded by this gene is one of the eight subunits of COP9 signalosome, a highly conserved protein complex that functions as an important regulator in multiple signaling pathways. The structure and function of COP9 signalosome is similar to that of the 19S regulatory particle of 26S proteasome. COP9 signalosome has been shown to interact with SCF-type E3 ubiquitin ligases and act as a positive regulator of E3 ubiquitin ligases. Alternatively spliced transcript variants encoding distinct isoforms have been observed.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: COPS8