COPS7A Recombinant Protein Antigen

Images

 
There are currently no images for COPS7A Protein (NBP1-84369PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

COPS7A Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human COPS7A.

Source: E.coli

Amino Acid Sequence: KVTGQNQEQFLLLAKSAKGAALATLIHQVLEAPGVYVFGELLDMPNVRELAESDFASTFRLLTVFAYGTYADYLAEARNLPPLTEAQKNKLRHLSVVTLAAKVKCIPYAVLLEALALRNVRQLEDLVIEAVYADVLRGSLD

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
COPS7A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-84369.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related protocol, click here.
Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for COPS7A Recombinant Protein Antigen

  • COP9 (constitutive photomorphogenic, Arabidopsis, homolog) subunit 7A
  • COP9 complex subunit 7a
  • COP9 constitutive photomorphogenic homolog subunit 7A (Arabidopsis)
  • COP9 signalosome complex subunit 7a
  • CSN7AMGC110877
  • Dermal papilla-derived protein 10
  • DERP10
  • JAB1-containing signalosome subunit 7a
  • SGN7a
  • Signalosome subunit 7a

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-56734
Species: Hu
Applications: ICC/IF
NB120-495
Species: Hu, Mu, Rt, Dr
Applications: WB, ICC/IF, IHC, IP
NBP1-32822
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBP1-84407
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85435
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91805
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87789
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-82580
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NB110-41622
Species: Hu, Mu, Rt, Po, Bv, Ch, Gt, Xp
Applications: WB, IHC, IHC-P
NBP1-87544
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-485
Species: Hu
Applications: WB, IP
NBP1-85436
Species: Hu
Applications: IHC, IHC-P
NBP2-38854
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00003400-B01P
Species: Hu
Applications: WB, ICC/IF
NBP2-27194
Species: Hu, Rt, Bv, Ch, Eq, Ha, Pm
Applications: WB, ICC/IF
NBP2-02136
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-24571
Species: Hu, Mu
Applications: WB, Simple Western, IHC-P
AF4377
Species: Hu, Mu
Applications: WB, ICC

Publications for COPS7A Protein (NBP1-84369PEP) (0)

There are no publications for COPS7A Protein (NBP1-84369PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for COPS7A Protein (NBP1-84369PEP) (0)

There are no reviews for COPS7A Protein (NBP1-84369PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for COPS7A Protein (NBP1-84369PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional COPS7A Products

Bioinformatics Tool for COPS7A Protein (NBP1-84369PEP)

Discover related pathways, diseases and genes to COPS7A Protein (NBP1-84369PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for COPS7A Protein (NBP1-84369PEP)

Discover more about diseases related to COPS7A Protein (NBP1-84369PEP).
 

Pathways for COPS7A Protein (NBP1-84369PEP)

View related products by pathway.

PTMs for COPS7A Protein (NBP1-84369PEP)

Learn more about PTMs related to COPS7A Protein (NBP1-84369PEP).

Blogs on COPS7A

There are no specific blogs for COPS7A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Nrf2 Antibody
NBP1-32822
Nrf2 Antibody
NBP1-32822
Nrf2 Antibody
NBP1-32822
COPS7A Antibody
NBP1-84369
COPS7A Antibody
NBP1-84369
SAT1 Antibody
NB110-41622
SAT1 Antibody
NB110-41622

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our COPS7A Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol COPS7A