COPB2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: COPB2 Antibody [NBP2-54952] - Staining of human cell line U-2 OS shows localization to cytosol.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

COPB2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GNANMVNKLAEGAERDGKNNVAFMSYFLQGKVDACLELLIRTGRLPEAAFLARTYLPSQVSRVVKLWRENLSKVNQKAAE
Specificity
Specificity of human COPB2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
COPB2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
COPB2 Recombinant Protein Antigen (NBP2-54952PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for COPB2 Antibody

  • beta prime subunit
  • Beta'-coat protein
  • Beta'-COP
  • betaprime-COP
  • coatomer protein complex, subunit beta 2 (beta prime)
  • coatomer subunit beta'
  • p102

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-505
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-22544
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NB100-856
Species: Hu
Applications: Flow, ICC/IF, PEP-ELISA
NBP2-55178
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89705
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-58200
Species: Hu, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22321
Species: Hu
Applications: WB, ICC/IF, IP
NBP2-00637
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-82455
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45458
Species: Hu
Applications: WB, IHC
NB100-1277
Species: Hu, Mu, Ma
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, IHC-WhMt
NBP2-38206
Species: Hu
Applications: WB, IHC, IHC-P, KD
NBP1-54825
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-75610
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-20486
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-33425
Species: Hu
Applications: WB, IHC, IHC-P
NB110-40591
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-21667
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NB200-106
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-16991
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for COPB2 Antibody (NBP2-54952) (0)

There are no publications for COPB2 Antibody (NBP2-54952).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for COPB2 Antibody (NBP2-54952) (0)

There are no reviews for COPB2 Antibody (NBP2-54952). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for COPB2 Antibody (NBP2-54952) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional COPB2 Products

Bioinformatics Tool for COPB2 Antibody (NBP2-54952)

Discover related pathways, diseases and genes to COPB2 Antibody (NBP2-54952). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for COPB2 Antibody (NBP2-54952)

Discover more about diseases related to COPB2 Antibody (NBP2-54952).
 

Pathways for COPB2 Antibody (NBP2-54952)

View related products by pathway.

Research Areas for COPB2 Antibody (NBP2-54952)

Find related products by research area.

Blogs on COPB2

There are no specific blogs for COPB2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our COPB2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol COPB2