Recombinant Human Connexin 37/GJA4 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human Connexin 37/GJA4 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-333 of Human GJA4 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MGDWGFLEKLLDQVQEHSTVVGKIWLTVLFIFRILILGLAGESVWGDEQSDFECNTAQPGCTNVCYDQAFPISHIRYWVLQFLFVSTPTLVYLGHVIYLSRREERLRQKEGELRALPAKDPQVERALAAVERQMAKISVAEDGRLRIRGALMGTYVASVLCKSVLEAGFLYGQWRLYGWTMEPVFVCQRAPCPYLVDCFVSRPTEKTIFIIFMLVVGLISLVLNLLELVHLLCRCLSRGMRARQGQDAPPTQGTSSDPYTDQVFFYLPVGQGPSSPPCPTYNGLSSSEQNWANLTTEERLASSRPPLFLDPPPQNGQKPPSRPSSSASKKQYV

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
GJA4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
63.8 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Connexin 37/GJA4 Protein

  • Connexin 37
  • Connexin-37
  • CX37
  • CX37connexin-37
  • gap junction alpha-4 protein
  • gap junction protein, alpha 4, 37kD (connexin 37)
  • gap junction protein, alpha 4, 37kDa (connexin 37)
  • gap junction protein, alpha 4, 37kDa
  • GJA4

Background

This gene encodes a member of the connexin gene family. The encoded protein is a component of gap junctions, which are composed of arrays of intercellular channels that provide a route for the diffusion of low molecular weight materials from cell to cell. Mutations in this gene have been associated with atherosclerosis and a higher risk of myocardial infarction. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29754
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-53384
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC-P
NBP2-58660
Species: Hu
Applications: IHC, IHC-P
NBP1-59254
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
NB300-500
Species: Hu, Mu, Rt, Po, Am, Bv, Ca, Dr
Applications: WB, IHC, IHC-Fr, IHC-P
AF4090
Species: Hu
Applications: WB, IHC, IP, Neut
NBP1-84333
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-55398
Species: Hu
Applications: WB, ICC/IF
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-62346
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-19773
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
H00002707-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
H00002701-P01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for Connexin 37/GJA4 Recombinant Protein (H00002701-P01) (0)

There are no publications for Connexin 37/GJA4 Recombinant Protein (H00002701-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Connexin 37/GJA4 Recombinant Protein (H00002701-P01) (0)

There are no reviews for Connexin 37/GJA4 Recombinant Protein (H00002701-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Connexin 37/GJA4 Recombinant Protein (H00002701-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Connexin 37/GJA4 Products

Bioinformatics Tool for Connexin 37/GJA4 Recombinant Protein (H00002701-P01)

Discover related pathways, diseases and genes to Connexin 37/GJA4 Recombinant Protein (H00002701-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Connexin 37/GJA4 Recombinant Protein (H00002701-P01)

Discover more about diseases related to Connexin 37/GJA4 Recombinant Protein (H00002701-P01).
 

Pathways for Connexin 37/GJA4 Recombinant Protein (H00002701-P01)

View related products by pathway.

PTMs for Connexin 37/GJA4 Recombinant Protein (H00002701-P01)

Learn more about PTMs related to Connexin 37/GJA4 Recombinant Protein (H00002701-P01).

Blogs on Connexin 37/GJA4

There are no specific blogs for Connexin 37/GJA4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Connexin 37/GJA4 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol GJA4
Entrez