Connexin 30.3/GJB4 Antibody


Western Blot: Connexin 30.3/GJB4 Antibody [NBP1-70506] - Jurkat cell lysate, concentration 1.25ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

Connexin 30.3/GJB4 Antibody Summary

Synthetic peptides corresponding to GJB4 (gap junction protein, beta 4) The peptide sequence was selected from the middle region of GJB4. Peptide sequence CPSLLVVMHVAYREERERKHHLKHGPNAPSLYDNLSKKRGGLWWTYLLSL.
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against GJB4 and was validated on Western blot.
Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Protein A purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Connexin 30.3/GJB4 Antibody

  • beta 4
  • Connexin 30.3
  • connexin-30.3
  • CX30.3
  • EKV
  • gap junction beta-4 protein
  • gap junction protein, beta 4 (connexin 30.3)
  • gap junction protein, beta 4, 30.3kDa
  • GJB4
  • MGC21116


Connexins are homologous four-transmembrane-domain proteins and major components of gap junctions. The GJB4 gene encodes connexin 30.3 (Cx30.3) A mutation in connexin 30.3 is causally involved in erythrokeratodermia variabilis (EKV), a mostly autosomal dominant disorder of keratinization.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Rt
Applications: WB, ICC/IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, IP
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, Flow, ICC/IF
Species: Hu
Applications: WB

Publications for Connexin 30.3/GJB4 Antibody (NBP1-70506) (0)

There are no publications for Connexin 30.3/GJB4 Antibody (NBP1-70506).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Connexin 30.3/GJB4 Antibody (NBP1-70506) (0)

There are no reviews for Connexin 30.3/GJB4 Antibody (NBP1-70506). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Connexin 30.3/GJB4 Antibody (NBP1-70506) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Connexin 30.3/GJB4 Products

Bioinformatics Tool for Connexin 30.3/GJB4 Antibody (NBP1-70506)

Discover related pathways, diseases and genes to Connexin 30.3/GJB4 Antibody (NBP1-70506). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Connexin 30.3/GJB4 Antibody (NBP1-70506)

Discover more about diseases related to Connexin 30.3/GJB4 Antibody (NBP1-70506).

Pathways for Connexin 30.3/GJB4 Antibody (NBP1-70506)

View related products by pathway.

Blogs on Connexin 30.3/GJB4

There are no specific blogs for Connexin 30.3/GJB4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Connexin 30.3/GJB4 Antibody and receive a gift card or discount.


Gene Symbol GJB4